Property Summary

NCBI Gene PubMed Count 11
Grant Count 1
Funding $201,369
PubMed Score 11.58
PubTator Score 8.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -3.149 0.000
tuberculosis 1.300 0.000
intraductal papillary-mucinous adenoma (... 2.100 0.000
intraductal papillary-mucinous neoplasm ... 2.900 0.002
active ulcerative colitis 1.465 0.024
nasopharyngeal carcinoma -1.400 0.000
psoriasis 1.500 0.000
pituitary cancer -1.200 0.002

Gene RIF (3)

PMID Text
21940674 TRIM28 is a specific SUMO E3 ligase of interferon regulatory factor (IRF)7 and negatively regulates its activity and interferon (IFN)-based antiviral responses, in support of the expanding roles of TRIM proteins which regulate innate immunity.
18854154 Knockdown of tripartite motif containing 7 (TRIM7) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
11916970 GNIP, a novel protein that binds and activates glycogenin, the self-glucosylating initiator of glycogen biosynthesis

AA Sequence

MAAVGPRTGPGTGAEALALAAELQGEATCSICLELFREPVSVECGHSFCRACIGRCWERPGAGSVGAATR      1 - 70
APPFPLPCPQCREPARPSQLRPNRQLAAVATLLRRFSLPAAAPGEHGSQAAAARAAAARCGQHGEPFKLY     71 - 140
CQDDGRAICVVCDRAREHREHAVLPLDEAVQEAKELLESRLRVLKKELEDCEVFRSTEKKESKELLKQMA    141 - 210
AEQEKVGAEFQALRAFLVEQEGRLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQIQETAQKPDLD    211 - 280
FLQEFKSTLSRCSNVPGPKPTTVSSEMKNKVWNVSLKTFVLKGMLKKFKEDLRGELEKEEKVELTLDPDT    281 - 350
ANPRLILSLDLKGVRLGERAQDLPNHPCRFDTNTRVLASCGFSSGRHHWEVEVGSKDGWAFGVARESVRR    351 - 420
KGLTPFTPEEGVWALQLNGGQYWAVTSPERSPLSCGHLSRVRVALDLEVGAVSFYAVEDMRHLYTFRVNF    421 - 490
QERVFPLFSVCSTGTYLRIWP                                                     491 - 511
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21940674 2011 Tripartite motif-containing protein 28 is a small ubiquitin-related modifier E3 ligase and negative regulator of IFN regulatory factor 7.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14984203 2004 Structure-function analysis of GNIP, the glycogenin-interacting protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11916970 2002 GNIP, a novel protein that binds and activates glycogenin, the self-glucosylating initiator of glycogen biosynthesis.
11331580 2001 The tripartite motif family identifies cell compartments.
More...