Property Summary

NCBI Gene PubMed Count 11
PubMed Score 11.58
PubTator Score 8.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 3.7457286956294E-14
nasopharyngeal carcinoma 1056 1.84705984178104E-9
osteosarcoma 7933 2.27872845672939E-9
tuberculosis 1563 6.74132217575478E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.96516539426899E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00164366291163237
pituitary cancer 1972 0.00171697639769523
active ulcerative colitis 477 0.0241417564310802

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -3.149 0.000
tuberculosis 1.300 0.000
intraductal papillary-mucinous adenoma (... 2.100 0.000
intraductal papillary-mucinous neoplasm ... 2.900 0.002
active ulcerative colitis 1.465 0.024
nasopharyngeal carcinoma -1.400 0.000
psoriasis 1.500 0.000
pituitary cancer -1.200 0.002

Synonym

Accession Q9C029 A2RUE4 D3DWR7 Q969F5 Q96F67 Q96J89 Q96J90
Symbols GNIP
RNF90

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Chicken OMA Inparanoid

Gene RIF (3)

PMID Text
21940674 TRIM28 is a specific SUMO E3 ligase of interferon regulatory factor (IRF)7 and negatively regulates its activity and interferon (IFN)-based antiviral responses, in support of the expanding roles of TRIM proteins which regulate innate immunity.
18854154 Knockdown of tripartite motif containing 7 (TRIM7) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
11916970 GNIP, a novel protein that binds and activates glycogenin, the self-glucosylating initiator of glycogen biosynthesis

AA Sequence

MAAVGPRTGPGTGAEALALAAELQGEATCSICLELFREPVSVECGHSFCRACIGRCWERPGAGSVGAATR      1 - 70
APPFPLPCPQCREPARPSQLRPNRQLAAVATLLRRFSLPAAAPGEHGSQAAAARAAAARCGQHGEPFKLY     71 - 140
CQDDGRAICVVCDRAREHREHAVLPLDEAVQEAKELLESRLRVLKKELEDCEVFRSTEKKESKELLKQMA    141 - 210
AEQEKVGAEFQALRAFLVEQEGRLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQIQETAQKPDLD    211 - 280
FLQEFKSTLSRCSNVPGPKPTTVSSEMKNKVWNVSLKTFVLKGMLKKFKEDLRGELEKEEKVELTLDPDT    281 - 350
ANPRLILSLDLKGVRLGERAQDLPNHPCRFDTNTRVLASCGFSSGRHHWEVEVGSKDGWAFGVARESVRR    351 - 420
KGLTPFTPEEGVWALQLNGGQYWAVTSPERSPLSCGHLSRVRVALDLEVGAVSFYAVEDMRHLYTFRVNF    421 - 490
QERVFPLFSVCSTGTYLRIWP                                                     491 - 511
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21940674 2011 Tripartite motif-containing protein 28 is a small ubiquitin-related modifier E3 ligase and negative regulator of IFN regulatory factor 7.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14984203 2004 Structure-function analysis of GNIP, the glycogenin-interacting protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11916970 2002 GNIP, a novel protein that binds and activates glycogenin, the self-glucosylating initiator of glycogen biosynthesis.
11331580 2001 The tripartite motif family identifies cell compartments.
More...