Property Summary

NCBI Gene PubMed Count 11
PubMed Score 14.52
PubTator Score 8.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
active ulcerative colitis 1.465 2.4e-02
intraductal papillary-mucinous adenoma (... 2.100 2.0e-04
intraductal papillary-mucinous neoplasm ... 2.900 1.6e-03
nasopharyngeal carcinoma -1.400 1.8e-09
osteosarcoma -3.149 2.3e-09
pituitary cancer -1.200 1.7e-03
psoriasis 1.500 3.7e-14
tuberculosis 1.300 6.7e-05

Gene RIF (3)

AA Sequence

MAAVGPRTGPGTGAEALALAAELQGEATCSICLELFREPVSVECGHSFCRACIGRCWERPGAGSVGAATR      1 - 70
APPFPLPCPQCREPARPSQLRPNRQLAAVATLLRRFSLPAAAPGEHGSQAAAARAAAARCGQHGEPFKLY     71 - 140
CQDDGRAICVVCDRAREHREHAVLPLDEAVQEAKELLESRLRVLKKELEDCEVFRSTEKKESKELLKQMA    141 - 210
AEQEKVGAEFQALRAFLVEQEGRLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQIQETAQKPDLD    211 - 280
FLQEFKSTLSRCSNVPGPKPTTVSSEMKNKVWNVSLKTFVLKGMLKKFKEDLRGELEKEEKVELTLDPDT    281 - 350
ANPRLILSLDLKGVRLGERAQDLPNHPCRFDTNTRVLASCGFSSGRHHWEVEVGSKDGWAFGVARESVRR    351 - 420
KGLTPFTPEEGVWALQLNGGQYWAVTSPERSPLSCGHLSRVRVALDLEVGAVSFYAVEDMRHLYTFRVNF    421 - 490
QERVFPLFSVCSTGTYLRIWP                                                     491 - 511
//

Text Mined References (12)

PMID Year Title