Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.50
PubTator Score 10.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -2.800 0.005
ependymoma -2.500 0.020
oligodendroglioma -2.600 0.007
cystic fibrosis 2.215 0.000
atypical teratoid / rhabdoid tumor -2.000 0.021
Atopic dermatitis -1.800 0.000
ulcerative colitis -3.400 0.000
breast carcinoma 1.500 0.001
fibroadenoma 1.500 0.009
interstitial cystitis 1.100 0.018
non primary Sjogren syndrome sicca -1.600 0.021
psoriasis -1.200 0.000
subependymal giant cell astrocytoma -3.630 0.006
lung adenocarcinoma 1.200 0.003
lung carcinoma 3.000 0.000
gastric carcinoma -1.500 0.029
ductal carcinoma in situ 2.300 0.009
ovarian cancer 1.100 0.020
pituitary cancer -3.400 0.000

Gene RIF (8)

PMID Text
24869658 mutation of the pseudosubstrate domain abolished the inhibitory activity of PKIB on protein kinase A activity, but had no effect on the interaction with GPR39, cell protection and induction of SRE-dependent transcription
23224602 PKIB overexpression was strongly correlated with pAkt expression and triple-negative breast cancer, suggesting that PKIB overexpression might contribute to the tumor behavior and development of breast cancers.
19483721 Findings show that PKIB and PKA-C kinase can have critical functions of aggressive phenotype of PCs through Akt phosphorylation and that they should be a promising molecular target for PC treatment.
19460752 Knockdown of protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19035091 PKIbeta may be a novel full-length gene related to human glioma and may provide a new way to gene therapy of glioma.
12061725 human PKIbeta gene (clone 436F11, GenBank with accession number: AF225513) was over-expressed in normal brain tissues
7684369 Functional studies of the mouse homolog
2052616 Functional studies of the rat homolog

AA Sequence

MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQL      1 - 70
EKPQNEEK                                                                   71 - 78
//

Text Mined References (16)

PMID Year Title
24869658 2014 Protein kinase inhibitor ? enhances the constitutive activity of G-protein-coupled zinc receptor GPR39.
23224602 2012 PKIB expression strongly correlated with phosphorylated Akt expression in breast cancers and also with triple-negative breast cancer subtype.
21531765 2011 High-throughput RNAi screening reveals novel regulators of telomerase.
19483721 2009 Overexpressing PKIB in prostate cancer promotes its aggressiveness by linking between PKA and Akt pathways.
19035091 2008 [Expression and characterizations of a novel full-length gene PKIbeta related to human glioma].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...