Property Summary

NCBI Gene PubMed Count 16
PubMed Score 8.17
PubTator Score 10.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active ulcerative colitis -2.186 2.4e-03
astrocytic glioma -2.800 4.5e-03
Atopic dermatitis -1.700 1.2e-03
atypical teratoid / rhabdoid tumor -1.500 4.5e-02
breast carcinoma 1.500 5.7e-04
cystic fibrosis 2.215 3.4e-05
ductal carcinoma in situ 2.300 8.8e-03
ependymoma -2.500 2.0e-02
fibroadenoma 1.500 9.0e-03
gastric carcinoma -1.500 2.9e-02
interstitial cystitis 1.100 1.8e-02
lung adenocarcinoma 1.200 3.3e-03
lung carcinoma 3.000 1.2e-30
non primary Sjogren syndrome sicca -1.600 2.1e-02
oligodendroglioma -2.600 6.5e-03
ovarian cancer 1.100 2.0e-02
pituitary cancer -3.400 5.5e-06
psoriasis -1.200 7.4e-19
subependymal giant cell astrocytoma -2.644 2.6e-02

Synonym

Accession Q9C010 B2RCK2 Q567T9 Q5T0Z7 PKI-beta
Symbols PRKACN2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

AA Sequence

MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQL      1 - 70
EKPQNEEK                                                                   71 - 78
//

Text Mined References (17)

PMID Year Title