Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.50
PubTator Score 10.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.19943560116869E-30
psoriasis 6685 7.38608946155757E-19
ulcerative colitis 2087 2.0640885703572E-6
pituitary cancer 1972 5.54599069612247E-6
cystic fibrosis 1670 3.42019886210384E-5
Atopic dermatitis 944 9.3805557196667E-5
breast carcinoma 1614 5.67636558400832E-4
lung adenocarcinoma 2714 0.00333502421706192
astrocytic glioma 2241 0.0045099746123917
subependymal giant cell astrocytoma 2287 0.00591340967505414
oligodendroglioma 2849 0.00650156155689216
ductal carcinoma in situ 1745 0.00881194525823957
fibroadenoma 557 0.00901608882149038
interstitial cystitis 2299 0.0181997073324751
ependymoma 2514 0.0196959869533032
ovarian cancer 8492 0.0204909395556961
atypical teratoid / rhabdoid tumor 4369 0.0205269893123915
non primary Sjogren syndrome sicca 840 0.0214273446070425
gastric carcinoma 832 0.0288936830404127
Disease Target Count Z-score Confidence
Oculodentodigital dysplasia 14 3.659 1.8

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -2.800 0.005
ependymoma -2.500 0.020
oligodendroglioma -2.600 0.007
cystic fibrosis 2.215 0.000
atypical teratoid / rhabdoid tumor -2.000 0.021
Atopic dermatitis -1.800 0.000
ulcerative colitis -3.400 0.000
breast carcinoma 1.500 0.001
fibroadenoma 1.500 0.009
interstitial cystitis 1.100 0.018
non primary Sjogren syndrome sicca -1.600 0.021
psoriasis -1.200 0.000
subependymal giant cell astrocytoma -3.630 0.006
lung adenocarcinoma 1.200 0.003
lung carcinoma 3.000 0.000
gastric carcinoma -1.500 0.029
ductal carcinoma in situ 2.300 0.009
ovarian cancer 1.100 0.020
pituitary cancer -3.400 0.000

Synonym

Accession Q9C010 B2RCK2 Q567T9 Q5T0Z7 PKI-beta
Symbols PRKACN2

Gene

  Ortholog (7)

Gene RIF (8)

PMID Text
24869658 mutation of the pseudosubstrate domain abolished the inhibitory activity of PKIB on protein kinase A activity, but had no effect on the interaction with GPR39, cell protection and induction of SRE-dependent transcription
23224602 PKIB overexpression was strongly correlated with pAkt expression and triple-negative breast cancer, suggesting that PKIB overexpression might contribute to the tumor behavior and development of breast cancers.
19483721 Findings show that PKIB and PKA-C kinase can have critical functions of aggressive phenotype of PCs through Akt phosphorylation and that they should be a promising molecular target for PC treatment.
19460752 Knockdown of protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19035091 PKIbeta may be a novel full-length gene related to human glioma and may provide a new way to gene therapy of glioma.
12061725 human PKIbeta gene (clone 436F11, GenBank with accession number: AF225513) was over-expressed in normal brain tissues
7684369 Functional studies of the mouse homolog
2052616 Functional studies of the rat homolog

AA Sequence

MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQL      1 - 70
EKPQNEEK                                                                   71 - 78
//

Text Mined References (16)

PMID Year Title
24869658 2014 Protein kinase inhibitor ? enhances the constitutive activity of G-protein-coupled zinc receptor GPR39.
23224602 2012 PKIB expression strongly correlated with phosphorylated Akt expression in breast cancers and also with triple-negative breast cancer subtype.
21531765 2011 High-throughput RNAi screening reveals novel regulators of telomerase.
19483721 2009 Overexpressing PKIB in prostate cancer promotes its aggressiveness by linking between PKA and Akt pathways.
19035091 2008 [Expression and characterizations of a novel full-length gene PKIbeta related to human glioma].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...