Property Summary

NCBI Gene PubMed Count 36
Grant Count 2
Funding $441,780
PubMed Score 34.83
PubTator Score 35.29

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9C009 Q9NS06
Symbols HFH1

Gene

 Grant Application (2)

Gene RIF (28)

PMID Text
26349968 we identified FOXQ1 as an oncogene to promote ESCC tumor cell proliferation and metastasis by negatively regulating CDH1 in esophageal squamous cell carcinoma cells
26159618 MiR-1271 inhibits cell proliferation, invasion, and epithelial-mesenchymal transition in gastric cancer by directly suppressing FOXQ1 expression.
26122655 FoxQ1 expression is negatively associated with the overall survival of PC patients, and that this protein may therefore represent a novel molecular target and new prognostic biomarker for PC.
25955104 Data suggest that forkhead box Q1 (FOXQ1) is a potential therapeutic target for the development of therapies for colorectal cancer.
25856555 miR-506 functions as a tumor suppressor miRNA in nasopharyngeal carcinoma; its suppressive effects are mediated chiefly by repressing FOXQ1 expression.
25502837 PDGFRalpha and beta can be directly regulated by Foxq1 or indirectly regulated through the Foxq1/Twist1 axis
25356753 NSCLC cells with silenced FoxQ1 had decreased cell proliferation, migration and invasion in cell culture and delayed growth of xenograft tumors in mice compared with corresponding control cells.
25287361 The induction of EMT by FOXQ1 defines a new transfer function in promoting cancer behind possible mechanisms.
25251503 critical role in the regulation of hepatocellular carcinoma development
25098939 Results demonstrate that miR-124 functions as a tumor-suppressive microRNA in nasopharyngeal carcinoma by repressing Foxq1 expression.
More...

AA Sequence

MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANSPAAGGGARDTQGDGEQSAGG      1 - 70
GPGAEEAIPAAAAAAVVAEGAEAGAAGPGAGGAGSGEGARSKPYTRRPKPPYSYIALIAMAIRDSAGGRL     71 - 140
TLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFR    141 - 210
RRRKRLSHRAPVPAPGLRPEEAPGLPAAPPPAPAAPASPRMRSPARQEERASPAGKFSSSFAIDSILRKP    211 - 280
FRSRRLRDTAPGTTLQWGAAPCPPLPAFPALLPAAPCRALLPLCAYGAGEPARLGAREAEVPPTAPPLLL    281 - 350
APLPAAAPAKPLRGPAAGGAHLYCPLRLPAALQAASVRRPGPHLPYPVETLLA                     351 - 403
//

Text Mined References (36)

PMID Year Title
26349968 2015 FOXQ1 promotes esophageal cancer proliferation and metastasis by negatively modulating CDH1.
26159618 2015 MiR-1271 Inhibits Cell Proliferation, Invasion and EMT in Gastric Cancer by Targeting FOXQ1.
26122655 2015 FoxQ1 is a Novel Molecular Target for Pancreatic Cancer and is Associated with Poor Prognosis.
25955104 2015 FOXQ1 mediates the crosstalk between TGF-? and Wnt signaling pathways in the progression of colorectal cancer.
25856555 2015 MiR-506 suppresses tumor proliferation and invasion by targeting FOXQ1 in nasopharyngeal carcinoma.
25502837 2015 PDGFR? and ? play critical roles in mediating Foxq1-driven breast cancer stemness and chemoresistance.
25356753 2014 Involvement of FoxQ1 in NSCLC through regulating EMT and increasing chemosensitivity.
25287361 2014 Forkhead factor FOXQ1 promotes TGF-?1 expression and induces epithelial-mesenchymal transition.
25251503 2015 Double-negative feedback loop between microRNA-422a and forkhead box (FOX)G1/Q1/E1 regulates hepatocellular carcinoma tumor growth and metastasis.
25098939 2014 MiR-124 suppresses tumor growth and metastasis by targeting Foxq1 in nasopharyngeal carcinoma.
More...