Property Summary

NCBI Gene PubMed Count 44
PubMed Score 41.69
PubTator Score 35.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Breast cancer -1.100 1.0e-03
pancreatic cancer 2.100 4.2e-07
active ulcerative colitis 3.009 1.7e-02
adult high grade glioma -1.800 3.0e-04
astrocytic glioma -1.200 4.5e-02
Astrocytoma, Pilocytic -1.500 5.1e-05
atypical teratoid / rhabdoid tumor -1.300 6.9e-04
ependymoma -1.600 3.5e-03
facioscapulohumeral dystrophy -2.500 2.6e-03
glioblastoma -1.200 7.6e-04
interstitial cystitis -3.000 4.1e-03
intraductal papillary-mucinous adenoma (... 2.300 2.3e-03
intraductal papillary-mucinous neoplasm ... 1.900 3.4e-02
invasive ductal carcinoma 1.099 4.3e-02
lung adenocarcinoma 1.200 9.9e-03
ovarian cancer 4.000 1.3e-08
pituitary cancer -1.100 1.4e-04
primary pancreatic ductal adenocarcinoma 2.384 1.3e-02
primitive neuroectodermal tumor -1.300 1.3e-02
psoriasis -1.500 1.2e-08
sonic hedgehog group medulloblastoma -1.300 2.0e-02
spina bifida -2.701 3.6e-02

Gene RIF (36)

AA Sequence

MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANSPAAGGGARDTQGDGEQSAGG      1 - 70
GPGAEEAIPAAAAAAVVAEGAEAGAAGPGAGGAGSGEGARSKPYTRRPKPPYSYIALIAMAIRDSAGGRL     71 - 140
TLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFR    141 - 210
RRRKRLSHRAPVPAPGLRPEEAPGLPAAPPPAPAAPASPRMRSPARQEERASPAGKFSSSFAIDSILRKP    211 - 280
FRSRRLRDTAPGTTLQWGAAPCPPLPAFPALLPAAPCRALLPLCAYGAGEPARLGAREAEVPPTAPPLLL    281 - 350
APLPAAAPAKPLRGPAAGGAHLYCPLRLPAALQAASVRRPGPHLPYPVETLLA                     351 - 403
//

Text Mined References (44)

PMID Year Title