Property Summary

NCBI Gene PubMed Count 46
Grant Count 38
R01 Count 29
Funding $2,910,924.97
PubMed Score 25.94
PubTator Score 48.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
glioblastoma 2.700 0.002
atypical teratoid / rhabdoid tumor 1.400 0.002
primary pancreatic ductal adenocarcinoma 1.009 0.011
non-small cell lung cancer -1.337 0.000
lung cancer -1.300 0.004
pilocytic astrocytoma 1.600 0.000
posterior fossa group B ependymoma -1.200 0.000
lung carcinoma -1.200 0.000
ovarian cancer 1.300 0.001
pituitary cancer -2.300 0.000
pancreatic cancer 1.300 0.012

Gene RIF (32)

PMID Text
26392417 Results identify the tumor suppressor SPRY4 as a novel molecular effector of MT1-MMP affecting melanoma cell motility.
26286024 Data show that proto-oncogene protein B-raf (BRAF) inhibition induces c-Jun N-terminal kinase (c-JUN) expression and c-JUN abundance and activation by down-regulating SPRY2/4 protein expression.
26204823 SPRY4 is often deleted in secondary acute myeloid leukemia.
25957915 Specific protein 1 plays a crucial role in the regulation of Sprouty4 in response to serum.
25742952 ZNF703 was a target of SPRY4-IT1.
25630587 Sprouty 2 protein, but not Sprouty 4, is an independent prognostic biomarker for human epithelial ovarian cancer.
25344859 these results suggest the possibility that SPRY4-IT1 knockdown may induce apoptosis via lipin 2-mediated alterations in lipid metabolism leading to cellular lipotoxicity.
24811094 SPRY4 may function as a tumor suppressor in endometrial adenocarcinoma.
24810925 demonstrated that knockdown of SPRY4-IT1 reduced cell proliferation, invasiveness, and migration
24732356 Overexpression of Sprouty4 or pharmacological inhibition of ERK upregulated IL-1R1 expression in primary T cells.Sprouty4 and ERK play a critical role in developing iTh17 cells in Th17 cell-driven autoimmune diseases.
More...

AA Sequence

MEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLTILPIDQVKTSHVENDYIDNPSLALTTGPKRTRGG      1 - 70
APELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQP     71 - 140
LDLKGPAVPPELDKHFLLCEACGKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYHC    141 - 210
TNEDDEGSCADHPCSCSRSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNS    211 - 280
VICKAASGDAKTSRPDKPF                                                       281 - 299
//

Text Mined References (52)

PMID Year Title
26392417 2015 MT1-MMP dependent repression of the tumor suppressor SPRY4 contributes to MT1-MMP driven melanoma cell motility.
26286024 2015 The transcription cofactor c-JUN mediates phenotype switching and BRAF inhibitor resistance in melanoma.
26204823 2015 Deletion of SPRY4 is a frequent event in secondary acute myeloid leukemia.
25957915 2015 The increased Sprouty4 expression in response to serum is transcriptionally controlled by Specific protein 1.
25742952 2015 The long noncoding RNA SPRY4-IT1 increases the proliferation of human breast cancer cells by upregulating ZNF703 expression.
25630587 2015 Sprouty 2 protein, but not Sprouty 4, is an independent prognostic biomarker for human epithelial ovarian cancer.
25344859 2014 The functional characterization of long noncoding RNA SPRY4-IT1 in human melanoma cells.
24811094 2014 SPRY4-mediated ERK1/2 signaling inhibition abolishes 17?-estradiol-induced cell growth in endometrial adenocarcinoma cell.
24810925 2014 Long noncoding RNA SPRY4-IT1 is upregulated in esophageal squamous cell carcinoma and associated with poor prognosis.
24732356 2014 Loss of Sprouty4 in T cells ameliorates experimental autoimmune encephalomyelitis in mice by negatively regulating IL-1? receptor expression.
More...