Property Summary

NCBI Gene PubMed Count 54
PubMed Score 31.02
PubTator Score 48.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Astrocytoma, Pilocytic 1.600 1.3e-05
atypical teratoid / rhabdoid tumor 1.400 2.2e-03
glioblastoma 1.300 4.6e-03
lung cancer -1.300 3.7e-03
lung carcinoma -1.200 1.3e-07
malignant mesothelioma -1.800 1.3e-07
non-small cell lung cancer -1.337 8.9e-12
ovarian cancer -1.100 2.6e-04
pancreatic cancer 1.300 1.2e-02
pituitary cancer -2.300 1.0e-10
posterior fossa group B ependymoma -1.200 3.3e-05
primary pancreatic ductal adenocarcinoma 1.009 1.1e-02

Protein-protein Interaction (1)

Gene RIF (39)

AA Sequence

MEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLTILPIDQVKTSHVENDYIDNPSLALTTGPKRTRGG      1 - 70
APELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQP     71 - 140
LDLKGPAVPPELDKHFLLCEACGKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYHC    141 - 210
TNEDDEGSCADHPCSCSRSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNS    211 - 280
VICKAASGDAKTSRPDKPF                                                       281 - 299
//

Text Mined References (59)

PMID Year Title