Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.79
PubTator Score 6.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma 1.700 0.000
non-small cell lung carcinoma 1.500 0.000
psoriasis 1.400 0.000

Synonym

Accession Q9C002
Symbols NMES1
FOAP-11

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
12209954 The negative correlation of NMES1 expression with esophageal oncogenesis suggests its suppressive role in tumorigenesis of the esophagus, while the precise function of NMES1 still needs further investigation.

AA Sequence

MSFFQLLMKRKELIPLVVFMTVAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWK      1 - 70
PIEELQNVQRVTK                                                              71 - 83
//

Text Mined References (7)

PMID Year Title
22464673 2012 A regulatory dendritic cell signature correlates with the clinical efficacy of allergen-specific sublingual immunotherapy.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18636205 2008 Analysis of the methylation status of genes up-regulated by the demethylating agent, 5-aza-2'-deoxycytidine, in esophageal squamous cell carcinoma.
16434596 2006 Discovery of novel methylation biomarkers in cervical carcinoma by global demethylation and microarray analysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12209954 2002 A novel gene, NMES1, downregulated in human esophageal squamous cell carcinoma.