Property Summary

NCBI Gene PubMed Count 99
PubMed Score 116.48
PubTator Score 102.03

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.400 6.6e-03
atypical teratoid / rhabdoid tumor 1.400 6.2e-03
cystic fibrosis -1.332 6.1e-06
glioblastoma 1.300 5.9e-03
group 3 medulloblastoma -1.400 3.1e-03
inflammatory breast cancer -1.500 1.6e-03
intraductal papillary-mucinous carcinoma... -1.400 3.9e-02
lung cancer -1.100 8.8e-04
lung carcinoma -1.100 5.9e-20
malignant mesothelioma -2.400 3.9e-08
medulloblastoma, large-cell 2.000 1.8e-04
non-small cell lung cancer -1.127 2.6e-10
osteosarcoma -2.147 2.8e-05
ovarian cancer 1.500 1.9e-09
psoriasis -1.200 1.7e-06
subependymal giant cell astrocytoma 1.136 1.8e-02

Gene RIF (85)

AA Sequence

MAGGAWGRLACYLEFLKKEELKEFQLLLANKAHSRSSSGETPAQPEKTSGMEVASYLVAQYGEQRAWDLA      1 - 70
LHTWEQMGLRSLCAQAQEGAGHSPSFPYSPSEPHLGSPSQPTSTAVLMPWIHELPAGCTQGSERRVLRQL     71 - 140
PDTSGRRWREISASLLYQALPSSPDHESPSQESPNAPTSTAVLGSWGSPPQPSLAPREQEAPGTQWPLDE    141 - 210
TSGIYYTEIREREREKSEKGRPPWAAVVGTPPQAHTSLQPHHHPWEPSVRESLCSTWPWKNEDFNQKFTQ    211 - 280
LLLLQRPHPRSQDPLVKRSWPDYVEENRGHLIEIRDLFGPGLDTQEPRIVILQGAAGIGKSTLARQVKEA    281 - 350
WGRGQLYGDRFQHVFYFSCRELAQSKVVSLAELIGKDGTATPAPIRQILSRPERLLFILDGVDEPGWVLQ    351 - 420
EPSSELCLHWSQPQPADALLGSLLGKTILPEASFLITARTTALQNLIPSLEQARWVEVLGFSESSRKEYF    421 - 490
YRYFTDERQAIRAFRLVKSNKELWALCLVPWVSWLACTCLMQQMKRKEKLTLTSKTTTTLCLHYLAQALQ    491 - 560
AQPLGPQLRDLCSLAAEGIWQKKTLFSPDDLRKHGLDGAIISTFLKMGILQEHPIPLSYSFIHLCFQEFF    561 - 630
AAMSYVLEDEKGRGKHSNCIIDLEKTLEAYGIHGLFGASTTRFLLGLLSDEGEREMENIFHCRLSQGRNL    631 - 700
MQWVPSLQLLLQPHSLESLHCLYETRNKTFLTQVMAHFEEMGMCVETDMELLVCTFCIKFSRHVKKLQLI    701 - 770
EGRQHRSTWSPTMVVLFRWVPVTDAYWQILFSVLKVTRNLKELDLSGNSLSHSAVKSLCKTLRRPRCLLE    771 - 840
TLRLAGCGLTAEDCKDLAFGLRANQTLTELDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQLVSCGLTSDC    841 - 910
CQDLASVLSASPSLKELDLQQNNLDDVGVRLLCEGLRHPACKLIRLGLDQTTLSDEMRQELRALEQEKPQ    911 - 980
LLIFSRRKPSVMTPTEGLDTGEMSNSTSSLKRQRLGSERAASHVAQANLKLLDVSKIFPIAEIAEESSPE    981 - 1050
VVPVELLCVPSPASQGDLHTKPLGTDDDFWGPTGPVATEVVDKEKNLYRVHFPVAGSYRWPNTGLCFVMR   1051 - 1120
EAVTVEIEFCVWDQFLGEINPQHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQMAHFKEE   1121 - 1190
GMLLEKPARVELHHIVLENPSFSPLGVLLKMIHNALRFIPVTSVVLLYHRVHPEEVTFHLYLIPSDCSIR   1191 - 1260
KAIDDLEMKFQFVRIHKPPPLTPLYMGCRYTVSGSGSGMLEILPKELELCYRSPGEDQLFSEFYVGHLGS   1261 - 1330
GIRLQVKDKKDETLVWEALVKPGDLMPATTLIPPARIAVPSPLDAPQLLHFVDQYREQLIARVTSVEVVL   1331 - 1400
DKLHGQVLSQEQYERVLAENTRPSQMRKLFSLSQSWDRKCKDGLYQALKETHPHLIMELWEKGSKKGLLP   1401 - 1470
LSS                                                                      1471 - 1473
//

Text Mined References (109)

PMID Year Title