Property Summary

NCBI Gene PubMed Count 89
Grant Count 79
R01 Count 38
Funding $8,330,052.23
PubMed Score 103.91
PubTator Score 102.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -2.400 0.000
psoriasis -1.200 0.000
osteosarcoma -2.147 0.000
medulloblastoma -1.400 0.000
cystic fibrosis -1.332 0.000
atypical teratoid / rhabdoid tumor 1.400 0.006
glioblastoma 1.300 0.006
medulloblastoma, large-cell -4.000 0.000
non-small cell lung cancer -1.127 0.000
intraductal papillary-mucinous carcinoma... -1.400 0.039
lung cancer -1.100 0.001
adult high grade glioma 1.400 0.007
subependymal giant cell astrocytoma 1.136 0.018
non-inflammatory breast cancer -1.800 0.001
lung carcinoma -1.100 0.000
ovarian cancer -3.100 0.000

Synonym

Accession Q9C000 E9PE50 I6L9D9 Q9BZZ8 Q9BZZ9 Q9H5Z7 Q9H5Z8 Q9HAV8 Q9UFT4 Q9Y2E0
Symbols NAC
CARD7
CIDED
NALP1
SLEV1
DEFCAP
PP1044
VAMAS1
CLR17.1
DEFCAP-L/S

Gene

PDB

1PN5   3KAT   4IFP   4IM6  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
2071 screening 1717 / 0 / 278431 Colorimetric Assay for Inhibitors for NALP1
2092 summary 0 / 0 / 0 Summary Assay for Inhibitors for NALP1
488841 screening 380 / 0 / 994 Single concentration confirmation of uHTS for the identification of inhibitors of NALP1 in yeast using a luminescent assay
488860 confirmatory 29 / 0 / 12 Dose Response confirmation of uHTS for the identification of inhibitors of NALP1 in yeast using a luminescent assay

Gene RIF (77)

PMID Text
26939933 The NLRP3 and NLRP1 inflammasomes are activated in Alzheimer's disease
26715049 NLRP1 inflammasome is activated by extracellular acidosis through ASIC1a signal pathway.
26232934 Nlrp1 inflammasome is downregulated in trauma patients
26079697 Ethanol-induced HMGB1 release is associated with NOX2/NLRP1 inflammasome signaling, which represents a novel mechanism of ethanol-associated neuron injury.
25814374 Letter: aspirin intake in peripheral arterial disease attenuates NLRP1 inflammasome gene expression in endothelial cells.
25744023 Human central Nervous System neurons express NLRP1 inflammasomes, which activate Casp1 and subsequently Casp6. Casp1 activation generates interleukin-1-beta-mediated neuroinflammation and Casp6 activation causes axonal degeneration.
25725098 these data identify NLRP1 as an essential mediator of the host immune response during IBD and cancer.
25626361 The data of this study suggested that NLRP1/caspase-1 signaling participates in the seizure-induced degenerative process in humans.
25611377 NALP1 is expressed low in colon cancer and associated with the survival and tumor metastasis of patients, and treatment with 5-aza-2-deoxycytidine can restore NALP1 levels to suppress the growth of colon cancer.
25556596 The NLRP1 variant rs12150220 (L155H) was associated with the development of preeclampsia (OR = 1.58), suggesting a role of this inflammasome receptor in the pathogenesis of this multifactorial disorder.
More...

AA Sequence

MAGGAWGRLACYLEFLKKEELKEFQLLLANKAHSRSSSGETPAQPEKTSGMEVASYLVAQYGEQRAWDLA      1 - 70
LHTWEQMGLRSLCAQAQEGAGHSPSFPYSPSEPHLGSPSQPTSTAVLMPWIHELPAGCTQGSERRVLRQL     71 - 140
PDTSGRRWREISASLLYQALPSSPDHESPSQESPNAPTSTAVLGSWGSPPQPSLAPREQEAPGTQWPLDE    141 - 210
TSGIYYTEIREREREKSEKGRPPWAAVVGTPPQAHTSLQPHHHPWEPSVRESLCSTWPWKNEDFNQKFTQ    211 - 280
LLLLQRPHPRSQDPLVKRSWPDYVEENRGHLIEIRDLFGPGLDTQEPRIVILQGAAGIGKSTLARQVKEA    281 - 350
WGRGQLYGDRFQHVFYFSCRELAQSKVVSLAELIGKDGTATPAPIRQILSRPERLLFILDGVDEPGWVLQ    351 - 420
EPSSELCLHWSQPQPADALLGSLLGKTILPEASFLITARTTALQNLIPSLEQARWVEVLGFSESSRKEYF    421 - 490
YRYFTDERQAIRAFRLVKSNKELWALCLVPWVSWLACTCLMQQMKRKEKLTLTSKTTTTLCLHYLAQALQ    491 - 560
AQPLGPQLRDLCSLAAEGIWQKKTLFSPDDLRKHGLDGAIISTFLKMGILQEHPIPLSYSFIHLCFQEFF    561 - 630
AAMSYVLEDEKGRGKHSNCIIDLEKTLEAYGIHGLFGASTTRFLLGLLSDEGEREMENIFHCRLSQGRNL    631 - 700
MQWVPSLQLLLQPHSLESLHCLYETRNKTFLTQVMAHFEEMGMCVETDMELLVCTFCIKFSRHVKKLQLI    701 - 770
EGRQHRSTWSPTMVVLFRWVPVTDAYWQILFSVLKVTRNLKELDLSGNSLSHSAVKSLCKTLRRPRCLLE    771 - 840
TLRLAGCGLTAEDCKDLAFGLRANQTLTELDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQLVSCGLTSDC    841 - 910
CQDLASVLSASPSLKELDLQQNNLDDVGVRLLCEGLRHPACKLIRLGLDQTTLSDEMRQELRALEQEKPQ    911 - 980
LLIFSRRKPSVMTPTEGLDTGEMSNSTSSLKRQRLGSERAASHVAQANLKLLDVSKIFPIAEIAEESSPE    981 - 1050
VVPVELLCVPSPASQGDLHTKPLGTDDDFWGPTGPVATEVVDKEKNLYRVHFPVAGSYRWPNTGLCFVMR   1051 - 1120
EAVTVEIEFCVWDQFLGEINPQHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQMAHFKEE   1121 - 1190
GMLLEKPARVELHHIVLENPSFSPLGVLLKMIHNALRFIPVTSVVLLYHRVHPEEVTFHLYLIPSDCSIR   1191 - 1260
KAIDDLEMKFQFVRIHKPPPLTPLYMGCRYTVSGSGSGMLEILPKELELCYRSPGEDQLFSEFYVGHLGS   1261 - 1330
GIRLQVKDKKDETLVWEALVKPGDLMPATTLIPPARIAVPSPLDAPQLLHFVDQYREQLIARVTSVEVVL   1331 - 1400
DKLHGQVLSQEQYERVLAENTRPSQMRKLFSLSQSWDRKCKDGLYQALKETHPHLIMELWEKGSKKGLLP   1401 - 1470
LSS                                                                      1471 - 1473
//

Text Mined References (99)

PMID Year Title
26939933 2016 The NLRP3 and NLRP1 inflammasomes are activated in Alzheimer's disease.
26715049 2015 Acid-sensing ion channel 1a contributes to the effect of extracellular acidosis on NLRP1 inflammasome activation in cortical neurons.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26232934 2015 Nlrp1 inflammasome is downregulated in trauma patients.
26086088 2015 Transcription Factor ATF4 Induces NLRP1 Inflammasome Expression during Endoplasmic Reticulum Stress.
26079697 2015 Ethanol directly induced HMGB1 release through NOX2/NLRP1 inflammasome in neuronal cells.
25814374 2015 Aspirin therapy inhibits NLRP1 (nucleotide-binding domain-like receptor protein 1) inflammasome gene expression in patients with peripheral artery disease.
25744023 2015 Neuronal NLRP1 inflammasome activation of Caspase-1 coordinately regulates inflammatory interleukin-1-beta production and axonal degeneration-associated Caspase-6 activation.
25725098 2015 The NLRP1 inflammasome attenuates colitis and colitis-associated tumorigenesis.
25626361 2015 NLRP1 inflammasome is activated in patients with medial temporal lobe epilepsy and contributes to neuronal pyroptosis in amygdala kindling-induced rat model.
More...