Property Summary

NCBI Gene PubMed Count 34
PubMed Score 27.25
PubTator Score 42.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.3e-05
tuberculosis and treatment for 6 months 409 1.3e-04
lung cancer 4740 1.9e-04
psoriasis 6694 3.0e-04
osteosarcoma 7950 4.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer 1.700 1.9e-04
osteosarcoma -1.108 4.2e-04
ovarian cancer 1.900 2.3e-05
psoriasis -1.100 3.0e-04
tuberculosis and treatment for 6 months 1.200 1.3e-04

Gene RIF (15)

AA Sequence

MPTVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDL      1 - 70
CEDEDVSIRRQAIKELPQFATGENLPRVADILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQI     71 - 140
LQGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTGEEFVLFMKILSGLKSLQTVSGR    141 - 210
QQLVELVAEQADLEQTFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCEQVLPNLGTLTTPVEGL    211 - 280
DIQLEVLKLLAEMSSFCGDMEKLETNLRKLFDKLLEYMPLPPEEAENGENAGNEEPKLQFSYVECLLYSF    281 - 350
HQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNN    351 - 420
INVLIKDLFHIPPSYKSTVTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSS    421 - 490
NLGNFNYEQRGAFRGSRGGRGWGTRGNRSRGRLY                                        491 - 524
//

Text Mined References (45)

PMID Year Title