Property Summary

NCBI Gene PubMed Count 26
PubMed Score 152.65
PubTator Score 11.42

Knowledge Summary

Patent

No data available

Expression

 GO Component (2)

Gene RIF (7)

AA Sequence

MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSL      1 - 70
LRNLVEKIQALQASEVQSKRKEATCPRHQEMFHYFCEDDGKFLCFVCRESKDHKSHNVSLIEEAAQNYQG     71 - 140
QIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLSRIYWLGHEG    141 - 210
TEAGKHYVASTEPQLNDLKKLVDSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAK    211 - 280
SRHDSITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPP    281 - 350
NHHSSAPSHSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFC    351 - 420
EVPSS                                                                     421 - 425
//

Text Mined References (26)

PMID Year Title