Property Summary

NCBI Gene PubMed Count 25
Grant Count 13
R01 Count 11
Funding $1,413,617.67
PubMed Score 133.08
PubTator Score 11.42

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
25590999 TRIM31 directly binds to NSE4, suggesting the existence of a TRIM31-MAGEA1-NSE4 complex reminiscent of the NSE1-NSE3-NSE4 trimer.
24566900 TRIM31 might serve as a tumor suppressor in non-small cell lung cancer.
21302343 The TRIm31 gene is related to intelligence in an ADHD background.
21231912 The cellular level of TRIM31, an RBCC protein overexpressed in gastric cancer, is regulated by multiple mechanisms including the ubiquitin-proteasome system.
19851445 Observational study of gene-disease association. (HuGE Navigator)
18248090 HIV-1 infection is modestly restricted by human TRIM31. Gene silencing of endogenously expressed TRIM31inhibits viral release, suggesting the interaction between HIV-1 Gag and TRIM31

AA Sequence

MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSL      1 - 70
LRNLVEKIQALQASEVQSKRKEATCPRHQEMFHYFCEDDGKFLCFVCRESKDHKSHNVSLIEEAAQNYQG     71 - 140
QIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLSRIYWLGHEG    141 - 210
TEAGKHYVASTEPQLNDLKKLVDSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAK    211 - 280
SRHDSITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPP    281 - 350
NHHSSAPSHSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFC    351 - 420
EVPSS                                                                     421 - 425
//

Text Mined References (25)

PMID Year Title
25590999 2015 The melanoma-associated antigen 1 (MAGEA1) protein stimulates the E3 ubiquitin-ligase activity of TRIM31 within a TRIM31-MAGEA1-NSE4 complex.
25416956 2014 A proteome-scale map of the human interactome network.
25217961 2014 A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer.
24566900 2014 TRIM31 is downregulated in non-small cell lung cancer and serves as a potential tumor suppressor.
24489884 2014 Genome-wide association study of proneness to anger.
23417110 2013 Genome-wide association study identified the human leukocyte antigen region as a novel locus for plasma beta-2 microglobulin.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
21302343 2011 The ATXN1 and TRIM31 genes are related to intelligence in an ADHD background: evidence from a large collaborative study totaling 4,963 subjects.
21231912 2011 The cellular level of TRIM31, an RBCC protein overexpressed in gastric cancer, is regulated by multiple mechanisms including the ubiquitin-proteasome system.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
More...