Property Summary

NCBI Gene PubMed Count 23
PubMed Score 30.23
PubTator Score 69.13

Knowledge Summary

Patent (3,188)

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 6.8e-07
colon cancer 1.100 7.0e-03
ductal carcinoma in situ 1.200 1.7e-03
Endometriosis -1.430 1.1e-02
glioblastoma 1.200 3.8e-04
group 3 medulloblastoma 1.400 1.9e-03
invasive ductal carcinoma 1.600 2.2e-03
lung cancer 3.600 3.0e-05
lung carcinoma 1.100 8.5e-27
medulloblastoma, large-cell 1.900 2.2e-05
non-small cell lung cancer 2.107 8.5e-18
ovarian cancer 1.500 5.7e-08
primitive neuroectodermal tumor 1.100 1.9e-03
psoriasis 1.100 2.5e-07

Protein-protein Interaction (4)

Gene RIF (11)

AA Sequence

MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTS      1 - 70
EQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAF     71 - 140
YSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPR    141 - 210
GADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH                       211 - 261
//

Text Mined References (28)

PMID Year Title