Property Summary

NCBI Gene PubMed Count 21
PubMed Score 27.71
PubTator Score 69.13

Knowledge Summary

Patent (3,188)

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis 1.100 0.000
group 3 medulloblastoma 1.400 0.002
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.900 0.000
primitive neuroectodermal tumor 1.100 0.002
non-small cell lung cancer 2.107 0.000
lung cancer 4.000 0.000
colon cancer 1.100 0.007
Endometriosis -1.430 0.011
lung carcinoma 1.100 0.000
ductal carcinoma in situ 1.200 0.002
invasive ductal carcinoma 1.600 0.002
ovarian cancer 1.500 0.000

Synonym

Accession Q9BZX2 Q5VV91 Q7KZV3 Q92528 Q96KG5 Q9BU42 UCK 2
Symbols UK
UMPK
TSA903

Gene

PANTHER Protein Class (3)

PDB

1UDW   1UEI   1UEJ   1UFQ   1UJ2   1XRJ  

 Collection (1)

Gene RIF (9)

PMID Text
23462292 Testicular germ cell tumor susceptibility associated with the UCK2 locus on chromosome 1q23.
19536175 Observational study of gene-disease association. (HuGE Navigator)
19532987 The mechanism of phosphate transfer in UCK2 is shown to be concerted, and is accompanied by concerted proton transfer from the 5'-hydroxyl to a conserved active site aspartic acid that serves as a catalytic base
19064610 Observational study of gene-disease association. (HuGE Navigator)
18051367 HIV-1 NC upregulates uridine-cytidine kinase 2 in HEK 293T cells
17613536 B4GALT3, DAP3, RGS16, TMEM183A and UCK2--were significantly overexpressed in dup(1q)-positive ALLs compared with high hyperdiploid ALLs without dup(1q).
16484797 gene mapped to chromosome 1.
15280220 UCK2 is responsible for phosphorylation and activation of the antitumor activity of 3'-ethynyl nucleosides 1-(3-C-ethynyl-beta-D-ribopentofuranosyl)cytosine and 1-(3-C-ethynyl-beta-D-ribopentofuranosyl)uridine.
12199906 Increased intranuclear levels of UK may contribute to the metabolic build-up that is needed for Epstein-Barr virus nuclear protein EBNA-3-mediated B-cell blast transformation and rapid proliferation.

AA Sequence

MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTS      1 - 70
EQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAF     71 - 140
YSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPR    141 - 210
GADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH                       211 - 261
//

Text Mined References (26)

PMID Year Title
23666240 2013 Identification of nine new susceptibility loci for testicular cancer, including variants near DAZL and PRDM14.
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
23462292 2013 Testicular germ cell tumor susceptibility associated with the UCK2 locus on chromosome 1q23.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19532987 2009 Quantum mechanics/molecular mechanics investigation of the mechanism of phosphate transfer in human uridine-cytidine kinase 2.
19483681 2009 A genome-wide association study of testicular germ cell tumor.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
More...