Property Summary

NCBI Gene PubMed Count 99
PubMed Score 197.23
PubTator Score 209.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Arthritis, Rheumatoid 174 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 3.2e-07
lung cancer 4740 1.1e-02
acute myeloid leukemia 783 2.6e-02
Disease Target Count Z-score Confidence
Lymphoproliferative syndrome 58 4.804 2.4
Disease Target Count
Rheumatoid arthritis 1191

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia 1.100 2.6e-02
lung cancer -1.100 1.1e-02
osteosarcoma -2.959 3.2e-07

Gene RIF (68)

AA Sequence

MLGQVVTLILLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWE      1 - 70
NGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQ     71 - 140
GQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESH    141 - 210
TLNLTQDCQNAHQEFRFWPFLVIIVILSALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDVKDLKTR    211 - 280
RNHEQEQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQP    281 - 350
KAQNPARLSRKELENFDVYS                                                      351 - 370
//

Text Mined References (102)

PMID Year Title