Property Summary

NCBI Gene PubMed Count 88
Grant Count 56
R01 Count 28
Funding $7,260,993.4
PubMed Score 190.07
PubTator Score 209.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.959 0.000
lung cancer -1.100 0.011
acute myeloid leukemia 1.100 0.026

Synonym

Accession Q9BZW8 Q5VYI2 Q5VYI6 Q5VYI7 Q96T47 Q9NQD2 Q9NQD3 Q9Y288
Symbols 2B4
NAIL
Nmrk
NKR2B4
SLAMF4

Gene

Gene RIF (62)

PMID Text
26314831 SLAMF4 gene and surface protein expression was down-regulated in CD8+ T cells from SLE patients compared with that in cells obtained from healthy donors. SLAMF4+ effector memory cells produced more granzyme B and perforin than SLAMF4- cells.
26170387 Cytomegalovirus-Induced Expression of CD244 after Liver Transplantation Is Associated with CD8+ T Cell Hyporesponsiveness to Alloantigen
26150504 CD244 expression/signaling in tuberculosis correlates with high levels of a long noncoding RNA (lncRNA)-BC050410 [named as lncRNA-AS-GSTT1(1-72) or lncRNA-CD244] in the CD244(+)CD8(+) T-cell subpopulation.
26022178 GSK-3 undergoes inhibitory phosphorylation at regulatory serine residues by the engagement of NKG2D and 2B4, either individually or in combination.
25824372 show that in addition to NKG2D, human CEACAM1 can inhibit NK-cell activation via NKp30 or 2B4
25722295 CD8(+) T cells require 2B4 for Epstein-Barr virus-specific immune control, because 2B4 blockade after CD8(+) T-cell depletion did not further aggravate symptoms of the infection.
25545687 this study investigates the structural requirements for the recruitment of the human-activating NK-cell receptors NKG2D and 2B4 to detergent-resistant membrane fractions in the murine BA/F3 cell line and in the human NK-cell line NKL.
24985396 Study of SAP expression is specific but may have insufficient sensitivity for screening XLP1 as a single tool; however, combination with 2B4 functional assay allows identification of all cases
24659462 In patients suffering from X-linked lymphoproliferative disease (XLP1), SAP is nonfunctional, not only abolishing the activating function of 2B4, but rendering this receptor inhibitory.
24505299 Blockade of 2B4/CD48 interaction resulted in improvement in function via perforin expression and degranulation as measured by CD107a surface mobilization on HTLV-1 specific CD8+ T cells.
More...

AA Sequence

MLGQVVTLILLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWE      1 - 70
NGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQ     71 - 140
GQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESH    141 - 210
TLNLTQDCQNAHQEFRFWPFLVIIVILSALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDVKDLKTR    211 - 280
RNHEQEQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQP    281 - 350
KAQNPARLSRKELENFDVYS                                                      351 - 370
//

Text Mined References (92)

PMID Year Title
26314831 2016 Selective Loss of Signaling Lymphocytic Activation Molecule Family Member 4-Positive CD8+ T Cells Contributes to the Decreased Cytotoxic Cell Activity in Systemic Lupus Erythematosus.
26221972 2015 A polymorphism in a phosphotyrosine signalling motif of CD229 (Ly9, SLAMF3) alters SH2 domain binding and T-cell activation.
26170387 2015 Cytomegalovirus-Induced Expression of CD244 after Liver Transplantation Is Associated with CD8+ T Cell Hyporesponsiveness to Alloantigen.
26150504 2015 Long noncoding RNA derived from CD244 signaling epigenetically controls CD8+ T-cell immune responses in tuberculosis infection.
26022178 2015 NK cell function triggered by multiple activating receptors is negatively regulated by glycogen synthase kinase-3?.
25824372 2015 Inhibition of NKp30- and 2B4-mediated NK cell activation by evolutionary different human and bovine CEACAM1 receptors.
25722295 2015 Role of the 2B4 Receptor in CD8+ T-Cell-Dependent Immune Control of Epstein-Barr Virus Infection in Mice With Reconstituted Human Immune System Components.
25545687 2015 Recruitment of activating NK-cell receptors 2B4 and NKG2D to membrane microdomains in mammalian cells is dependent on their transmembrane regions.
24985396 2014 Diagnosing XLP1 in patients with hemophagocytic lymphohistiocytosis.
24659462 2014 WhatSAP - 2B4 sends mixed messages in the absence of SAP.
More...