Property Summary

NCBI Gene PubMed Count 15
PubMed Score 13.08
PubTator Score 15.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -2.200 0.000
osteosarcoma -2.659 0.000
posterior fossa group B ependymoma 3.200 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.001
nasopharyngeal carcinoma -1.400 0.000
lung carcinoma 1.400 0.000
pituitary cancer 1.700 0.000

Gene RIF (7)

PMID Text
26573430 Overexpression of TSGA10 would induce disruption of HIF-1alpha axis and exert potent inhibitory effects on tumor angiogenesis and metastasis.
24294352 Report role for mir-577/TSGA10 axis in regulation esophageal squamous cell carcinoma progression.
21198756 TSGA10 should be considered as an autoantigen in a subset of autoimmune polyendocrine syndrome type 1 patients and also in a minority of systemic lupus erythematosus patients
20797700 TSGA10 could influence the function of antigen presenting cells via its interaction with cytoskeletal proteins such as vimentin
18000009 TSGA10 is target of immune reactions in Autoimmune polyendocrine syndrome type 1 (APS1).
16406020 The RT-PCR of TSGA10 expression may help in detection of residual clonal cells leading to early diagnosis and better prognostic qualification of the acute lymphoblastic leukemia.
15107545 over-expressed in 4 of 20 hepatocellular carcinomas (HCC), 1 of 20 colon cancers, 7 of 20 ovarian cancers, 3 of 20 prostate cancers, 1 of 21 malignant melanomas, and 8 of 21 bladder cancers

AA Sequence

MMRSRSKSPRRPSPTARGANCDVELLKTTTRDREELKCMLEKYERHLAEIQGNVKVLKSERDKIFLLYEQ      1 - 70
AQEEITRLRREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHL     71 - 140
EQRIEELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLYENT    141 - 210
EKDLSDTQRHLAKKKYELQLTQEKIMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKK    211 - 280
SENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQDVSRMRRQLDETNDELAQIARERDIL    281 - 350
AHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESENRQMMEQLRKA    351 - 420
NEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKM    421 - 490
EEELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIELLRSQMANE    491 - 560
RISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDIT    561 - 630
KRQLGTERFERERAVQELRRQNYSSNAYHMSSTMKPNTKCHSPERAHHRSPDRGLDRSLEENLCYRDF      631 - 698
//

Text Mined References (18)

PMID Year Title
26573430 2016 New function of TSGA10 gene in angiogenesis and tumor metastasis: a response to a challengeable paradox.
25416956 2014 A proteome-scale map of the human interactome network.
24294352 2013 Effects and interactions of MiR-577 and TSGA10 in regulating esophageal squamous cell carcinoma.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21198756 2011 TSGA10 - A target for autoantibodies in autoimmune polyendocrine syndrome type 1 and systemic lupus erythematosus.
20797700 2010 Filament-associated TSGA10 protein is expressed in professional antigen presenting cells and interacts with vimentin.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18000009 2008 Testis-expressed protein TSGA10 an auto-antigen in autoimmune polyendocrine syndrome type I.
16406020 2006 Expression of the testis-specific gene, TSGA10, in Iranian patients with acute lymphoblastic leukemia (ALL).
More...