Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.15
PubTator Score 1.84

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MSASAATGVFVLSLSAIPVTYVFNHLAAQHDSWTIVGVAALILFLVALLARVLVKRKPPRDPLFYVYAVF      1 - 70
GFTSVVNLIIGLEQDGIIDGFMTHYLREGEPYLNTAYGHMICYWDGSAHYLMYLVMVAAIAWEETYRTIG     71 - 140
LYWVGSIIMSVVVFVPGNIVGKYGTRICPAFFLSIPYTCLPVWAGFRIYNQPSENYNYPSKVIQEAQAKD    141 - 210
LLRRPFDLMLVVCLLLATGFCLFRGLIALDCPSELCRLYTQFQEPYLKDPAAYPKIQMLAYMFYSVPYFV    211 - 280
TALYGLVVPGCSWMPDITLIHAGGLAQAQFSHIGASLHARTAYVYRVPEEAKILFLALNIAYGVLPQLLA    281 - 350
YRCIYKPEFFIKTKAEEKVE                                                      351 - 370
//

Text Mined References (8)

PMID Year Title