Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.15
PubTator Score 1.84

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BZW5 A8K7T5 H3BU56 Q4U0U5
Symbols

Gene

Gene RIF (1)

PMID Text
25123395 Data conclude that AKR1B1 and TM6SF1 may serve as candidate methylation biomarkers for early breast cancer detection.

AA Sequence

MSASAATGVFVLSLSAIPVTYVFNHLAAQHDSWTIVGVAALILFLVALLARVLVKRKPPRDPLFYVYAVF      1 - 70
GFTSVVNLIIGLEQDGIIDGFMTHYLREGEPYLNTAYGHMICYWDGSAHYLMYLVMVAAIAWEETYRTIG     71 - 140
LYWVGSIIMSVVVFVPGNIVGKYGTRICPAFFLSIPYTCLPVWAGFRIYNQPSENYNYPSKVIQEAQAKD    141 - 210
LLRRPFDLMLVVCLLLATGFCLFRGLIALDCPSELCRLYTQFQEPYLKDPAAYPKIQMLAYMFYSVPYFV    211 - 280
TALYGLVVPGCSWMPDITLIHAGGLAQAQFSHIGASLHARTAYVYRVPEEAKILFLALNIAYGVLPQLLA    281 - 350
YRCIYKPEFFIKTKAEEKVE                                                      351 - 370
//

Text Mined References (7)

PMID Year Title
25566323 2014 TM6SF2 and MAC30, new enzyme homologs in sterol metabolism and common metabolic disease.
25123395 2014 Validation of DNA promoter hypermethylation biomarkers in breast cancer--a short report.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11124529 2000 Cloning of the novel gene TM6SF1 reveals conservation of clusters of paralogous genes between human chromosomes 15q24-->q26 and 19p13.3-->p12.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.