Property Summary

NCBI Gene PubMed Count 11
PubMed Score 62.69
PubTator Score 18.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.34941854723348E-8
non primary Sjogren syndrome sicca 840 0.0212046401623541
nephrosclerosis 329 0.0406446638139866
Disease Target Count Z-score Confidence
Diastrophic dysplasia 21 3.933 2.0
Nephrolithiasis 31 3.497 1.7

Synonym

Accession Q9BZW2 Q9H5Z0
Symbols NAS1
NaSi-1

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (4)

PMID Text
20670164 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19401682 Observational study of gene-disease association. (HuGE Navigator)
12867358 Amino acid residue Asn591, located in the carboxyl (COOH) terminus of NaSi-1, is used as the glycosylation site and is critical for transport activity in NaSi-1.
12857732 Serines 260 and 288 are involved in sulfate transport by hNaSi-1.

AA Sequence

MKFFSYILVYRRFLFVVFTVLVLLPLPIVLHTKEAECAYTLFVVATFWLTEALPLSVTALLPSLMLPMFG      1 - 70
IMPSKKVASAYFKDFHLLLIGVICLATSIEKWNLHKRIALKMVMMVGVNPAWLTLGFMSSTAFLSMWLSN     71 - 140
TSTAAMVMPIAEAVVQQIINAEAEVEATQMTYFNGSTNHGLEIDESVNGHEINERKEKTKPVPGYNNDTG    141 - 210
KISSKVELEKNSGMRTKYRTKKGHVTRKLTCLCIAYSSTIGGLTTITGTSTNLIFAEYFNTRYPDCRCLN    211 - 280
FGSWFTFSFPAALIILLLSWIWLQWLFLGFNFKEMFKCGKTKTVQQKACAEVIKQEYQKLGPIRYQEIVT    281 - 350
LVLFIIMALLWFSRDPGFVPGWSALFSEYPGFATDSTVALLIGLLFFLIPAKTLTKTTPTGEIVAFDYSP    351 - 420
LITWKEFQSFMPWDIAILVGGGFALADGCEESGLSKWIGNKLSPLGSLPAWLIILISSLMVTSLTEVASN    421 - 490
PATITLFLPILSPLAEAIHVNPLYILIPSTLCTSFAFLLPVANPPNAIVFSYGHLKVIDMVKAGLGVNIV    491 - 560
GVAVVMLGICTWIVPMFDLYTYPSWAPAMSNETMP                                       561 - 595
//

Text Mined References (11)

PMID Year Title
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
20670164 2010 Association of genetic polymorphisms with hepatotoxicity in patients with childhood acute lymphoblastic leukemia or lymphoma.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
16211368 2006 Molecular properties of the SLC13 family of dicarboxylate and sulfate transporters.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12867358 2003 Mutagenesis of the N-glycosylation site of hNaSi-1 reduces transport activity.
12857732 2003 Serines 260 and 288 are involved in sulfate transport by hNaSi-1.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...