Property Summary

NCBI Gene PubMed Count 12
PubMed Score 70.93
PubTator Score 18.51

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.3e-08
non primary Sjogren syndrome sicca 891 2.1e-02
nephrosclerosis 333 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
lung cancer 4740 0.0 0.6
Disease Target Count Z-score Confidence
Diastrophic dysplasia 21 4.003 2.0
Nephrolithiasis 56 3.502 1.8

Gene RIF (5)

AA Sequence

GVAVVMLGICTWIVPMFDLYTYPSWAPAMSNETMP                                       561 - 595

Text Mined References (12)

PMID Year Title