Property Summary

NCBI Gene PubMed Count 11
PubMed Score 62.69
PubTator Score 18.51

Knowledge Summary

Patent

No data available

Synonym

Accession Q9BZW2 Q9H5Z0
Symbols NAS1
NaSi-1

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
20670164 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19401682 Observational study of gene-disease association. (HuGE Navigator)
12867358 Amino acid residue Asn591, located in the carboxyl (COOH) terminus of NaSi-1, is used as the glycosylation site and is critical for transport activity in NaSi-1.
12857732 Serines 260 and 288 are involved in sulfate transport by hNaSi-1.

AA Sequence

MKFFSYILVYRRFLFVVFTVLVLLPLPIVLHTKEAECAYTLFVVATFWLTEALPLSVTALLPSLMLPMFG      1 - 70
IMPSKKVASAYFKDFHLLLIGVICLATSIEKWNLHKRIALKMVMMVGVNPAWLTLGFMSSTAFLSMWLSN     71 - 140
TSTAAMVMPIAEAVVQQIINAEAEVEATQMTYFNGSTNHGLEIDESVNGHEINERKEKTKPVPGYNNDTG    141 - 210
KISSKVELEKNSGMRTKYRTKKGHVTRKLTCLCIAYSSTIGGLTTITGTSTNLIFAEYFNTRYPDCRCLN    211 - 280
FGSWFTFSFPAALIILLLSWIWLQWLFLGFNFKEMFKCGKTKTVQQKACAEVIKQEYQKLGPIRYQEIVT    281 - 350
LVLFIIMALLWFSRDPGFVPGWSALFSEYPGFATDSTVALLIGLLFFLIPAKTLTKTTPTGEIVAFDYSP    351 - 420
LITWKEFQSFMPWDIAILVGGGFALADGCEESGLSKWIGNKLSPLGSLPAWLIILISSLMVTSLTEVASN    421 - 490
PATITLFLPILSPLAEAIHVNPLYILIPSTLCTSFAFLLPVANPPNAIVFSYGHLKVIDMVKAGLGVNIV    491 - 560
GVAVVMLGICTWIVPMFDLYTYPSWAPAMSNETMP                                       561 - 595
//

Text Mined References (11)

PMID Year Title
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
20670164 2010 Association of genetic polymorphisms with hepatotoxicity in patients with childhood acute lymphoblastic leukemia or lymphoma.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
16211368 2006 Molecular properties of the SLC13 family of dicarboxylate and sulfate transporters.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12867358 2003 Mutagenesis of the N-glycosylation site of hNaSi-1 reduces transport activity.
12857732 2003 Serines 260 and 288 are involved in sulfate transport by hNaSi-1.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...