Knowledge Summary

Patent

No data available

Synonym

Accession Q9BZS9
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MPYDQDSFSTLLGFLQASRKYSEFTLKCPICIYVPCQCFAVGFLKQSDQ                           1 - 49
//