Property Summary

NCBI Gene PubMed Count 27
PubMed Score 32.95
PubTator Score 14.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (8)

Disease log2 FC p
active ulcerative colitis 1.283 5.7e-03
aldosterone-producing adenoma -1.218 1.7e-02
COPD -1.300 9.8e-03
glioblastoma 1.300 1.2e-02
juvenile dermatomyositis 1.168 6.8e-12
osteosarcoma -2.619 4.4e-05
ovarian cancer 1.800 6.0e-04
psoriasis -2.900 3.1e-05

 GO Component (2)

Gene RIF (15)

AA Sequence

MAENWKNCFEEELICPICLHVFVEPVQLPCKHNFCRGCIGEAWAKDSGLVRCPECNQAYNQKPGLEKNLK      1 - 70
LTNIVEKFNALHVEKPPAALHCVFCRRGPPLPAQKVCLRCEAPCCQSHVQTHLQQPSTARGHLLVEADDV     71 - 140
RAWSCPQHNAYRLYHCEAEQVAVCQYCCYYSGAHQGHSVCDVEIRRNEIRKMLMKQQDRLEEREQDIEDQ    141 - 210
LYKLESDKRLVEEKVNQLKEEVRLQYEKLHQLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAK    211 - 280
KLLGSLQLLFDKTEDVSFMKNTKSVKILMDRTQTCTSSSLSPTKIGHLNSKLFLNEVAKKEKQLRKMLEG    281 - 350
PFSTPVPFLQSVPLYPCGVSSSGAEKRKHSTAFPEASFLETSSGPVGGQYGAAGTASGEGQSGQPLGPCS    351 - 420
STQHLVALPGGAQPVHSSPVFPPSQYPNGSAAQQPMLPQYGGRKILVCSVDNCYCSSVANHGGHQPYPRS    421 - 490
GHFPWTVPSQEYSHPLPPTPSVPQSLPSLAVRDWLDASQQPGHQDFYRVYGQPSTKHYVTS             491 - 551
//

Text Mined References (28)

PMID Year Title