Property Summary

NCBI Gene PubMed Count 25
Grant Count 17
R01 Count 15
Funding $4,457,229.37
PubMed Score 29.52
PubTator Score 14.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -2.900 0.000
osteosarcoma -2.619 0.000
glioblastoma 1.300 0.012
juvenile dermatomyositis 1.168 0.000
active ulcerative colitis 1.283 0.006
aldosterone-producing adenoma -1.218 0.017
COPD -1.300 0.010
ovarian cancer 2.400 0.000

Gene RIF (12)

PMID Text
26077989 Our study provides evidences that TRIM8 may participate in the carcinogenesis and progression of glioma and that the transcriptional repression of TRIM8 might have potential value for predicting poor prognosis in glioma patients.
25277184 These findings provide the first mechanistic link between TRIM8 and the drug resistance of clear cell Renal Cell Carcinoma
23152791 Nucleo-cytoplasmic trafficking of TRIM8, a novel oncogene, is involved in positive regulation of TNF induced NF-kappaB pathway.
22262183 TRIM8 is a p53 direct target gene that induces p53 stabilization and promotes the degradation of MDM2 protein.
22084099 Tripartite motif 8 (TRIM8) modulates TNFalpha- and IL-1beta-triggered NF-kappaB activation by targeting TAK1 for K63-linked polyubiquitination.
21689689 TRIM8 modulates translocation of phosphorylated STAT3 into the nucleus through interaction with Hsp90beta and consequently regulates transcription of Nanog in embryonic stem cells.
20516148 These findings indicate that TRIM8 enhances the STAT3-dependent signal pathway by inhibiting the function of PIAS3.
18854154 Knockdown of tripartite motif containing 8 (TRIM8) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17900511 Among genes correlated to nodal metastatic progression, we verified in vitro that NM23-H3 reduced cell motility and TRIM8 were a growth suppressor.
16385451 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAENWKNCFEEELICPICLHVFVEPVQLPCKHNFCRGCIGEAWAKDSGLVRCPECNQAYNQKPGLEKNLK      1 - 70
LTNIVEKFNALHVEKPPAALHCVFCRRGPPLPAQKVCLRCEAPCCQSHVQTHLQQPSTARGHLLVEADDV     71 - 140
RAWSCPQHNAYRLYHCEAEQVAVCQYCCYYSGAHQGHSVCDVEIRRNEIRKMLMKQQDRLEEREQDIEDQ    141 - 210
LYKLESDKRLVEEKVNQLKEEVRLQYEKLHQLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAK    211 - 280
KLLGSLQLLFDKTEDVSFMKNTKSVKILMDRTQTCTSSSLSPTKIGHLNSKLFLNEVAKKEKQLRKMLEG    281 - 350
PFSTPVPFLQSVPLYPCGVSSSGAEKRKHSTAFPEASFLETSSGPVGGQYGAAGTASGEGQSGQPLGPCS    351 - 420
STQHLVALPGGAQPVHSSPVFPPSQYPNGSAAQQPMLPQYGGRKILVCSVDNCYCSSVANHGGHQPYPRS    421 - 490
GHFPWTVPSQEYSHPLPPTPSVPQSLPSLAVRDWLDASQQPGHQDFYRVYGQPSTKHYVTS             491 - 551
//

Text Mined References (26)

PMID Year Title
27346735 2016 De Novo Truncating Mutation of TRIM8 Causes Early-Onset Epileptic Encephalopathy.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26077989 2015 TRIM8 downregulation in glioma affects cell proliferation and it is associated with patients survival.
25277184 2014 TRIM8 anti-proliferative action against chemo-resistant renal cell carcinoma.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23152791 2012 Nucleo-cytoplasmic trafficking of TRIM8, a novel oncogene, is involved in positive regulation of TNF induced NF-?B pathway.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
22829933 2012 TRIM27 negatively regulates NOD2 by ubiquitination and proteasomal degradation.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
More...