Property Summary

NCBI Gene PubMed Count 23
Grant Count 2
Funding $135,218
PubMed Score 16.26
PubTator Score 13.91

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
23077088 Data indicate that LRP6, BCL2L14, DUSP16, CREBL2, and CDKN1B were involed in centromeric (12p11.21-12p13.2) deletion in ETV6-RUNX1 B-cell precursor acute lymphoblastic leukemia (BCP-ALL).
22573796 Single nucleotide polymorphism in BCL2L14 is associated with lung cancer.
21550398 prior knockdown of Bcl-G expression ablates the stimulation of basal apoptosis by FAU, consistent with an essential downstream role for Bcl-G, itself a candidate tumour suppressor, in mediating the apoptosis regulatory role of FAU.
20855536 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19671159 siRNA downregulation of Bcl-G inhibited breast cancer cell apoptosis. Adding an siRNA against Fau revealed control of Bcl-G by Fau. The most important factors controlling Bcl-G are post-translational modification by Fau & MELK, not transcription rate.
19524489 Increased BclG(L) expression may contribute to the aberrant CD4+ T cell apoptosis which causes an inappropriate immune response and impaired homeostasis in systemic lupus erythematosus.
More...

AA Sequence

MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEV      1 - 70
SWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQC     71 - 140
LEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILA    141 - 210
KIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTA    211 - 280
KLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD                           281 - 327
//

Text Mined References (24)

PMID Year Title
23077088 2013 Abnormalities of the der(12)t(12;21) in ETV6-RUNX1 acute lymphoblastic leukemia.
22573796 2012 Multistage analysis of variants in the inflammation pathway and lung cancer risk in smokers.
21550398 2011 Candidate tumour suppressor Fau regulates apoptosis in human cells: an essential role for Bcl-G.
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19671159 2009 Dysregulated expression of Fau and MELK is associated with poor prognosis in breast cancer.
19524489 2009 Upregulated BclG(L) expression enhances apoptosis of peripheral blood CD4+ T lymphocytes in patients with systemic lupus erythematosus.
More...