Property Summary

NCBI Gene PubMed Count 23
PubMed Score 16.55
PubTator Score 13.91

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

AA Sequence

MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEV      1 - 70
SWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQC     71 - 140
LEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILA    141 - 210
KIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTA    211 - 280
KLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD                           281 - 327
//

Text Mined References (24)

PMID Year Title