Property Summary

NCBI Gene PubMed Count 68
PubMed Score 411.78
PubTator Score 140.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.000 6.9e-05
astrocytic glioma -1.700 1.6e-03
Astrocytoma, Pilocytic -2.800 4.9e-11
atypical teratoid / rhabdoid tumor -1.800 2.9e-05
ependymoma -1.600 2.4e-03
glioblastoma -2.000 3.5e-10
group 3 medulloblastoma -1.300 4.0e-02
medulloblastoma, large-cell -1.300 6.5e-03
oligodendroglioma -1.600 1.2e-17
subependymal giant cell astrocytoma -2.268 1.7e-02

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (39)

AA Sequence

MKRASAGGSRLLAWVLWLQAWQVAAPCPGACVCYNEPKVTTSCPQQGLQAVPVGIPAASQRIFLHGNRIS      1 - 70
HVPAASFRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLRSVDPATFHGLGRLHTLHLDRC     71 - 140
GLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRDLGNLTHLFLHGNRISSVPERAFRGLHSLDRLLLH    141 - 210
QNRVAHVHPHAFRDLGRLMTLYLFANNLSALPTEALAPLRALQYLRLNDNPWVCDCRARPLWAWLQKFRG    211 - 280
SSSEVPCSLPQRLAGRDLKRLAANDLQGCAVATGPYHPIWTGRATDEEPLGLPKCCQPDAADKASVLEPG    281 - 350
RPASAGNALKGRVPPGDSPPGNGSGPRHINDSPFGTLPGSAEPPLTAVRPEGSEPPGFPTSGPRRRPGCS    351 - 420
RKNRTRSHCRLGQAGSGGGGTGDSEGSGALPSLTCSLTPLGLALVLWTVLGPC                     421 - 473
//

Text Mined References (72)

PMID Year Title