Property Summary

NCBI Gene PubMed Count 63
Grant Count 152
R01 Count 91
Funding $15,875,543.57
PubMed Score 385.10
PubTator Score 140.53

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BZR6 D3DX28
Symbols NGR
NOGOR

Gene

PDB

1OZN   1P8T  

Gene RIF (36)

PMID Text
26083872 Messenger RNA expression from RTN4R in human cortical brain tissue correlated significantly with the genotypes of rs701427. Observations suggest that a functional RTN4R gene variant is associated with sporadic ALS.
25666623 Data indicate that leucine-rich repeat neuronal protein 1 (LINGO-1) is intracellular and competes with Nogo-66 receptor (NgR) for binding to p75 neurotrophin receptor (p75NTR).
24956133 Authors highlight the structural and biochemical aspects of the interaction of Nogo receptors (R1 and R2) with myelin inhibitors such as MAG, Nogo A and OMgp.[Review]
24922571 NgR1 is a neural entry mediator for mammalian reovirus.NgR1 is required for efficient infection of primary cortical neurons by reovirus.
24321711 This study demonistrated that alterations in DTI metrics suggest white matter microstructural anomalies of the cerebral cortex in 22q11.2DS. Structural differences in ALIC appear to be associated with the Nogo-66 receptor gene.
23982337 knockdown of NgR enhanced invasion and adhesion but increased cell apoptosis in C6 cells, suggesting that Nogo-66/NgR might have complex effects on glioma cells.
22903127 Strong overexpression of Nogo receptor 1 in forebrain neurons impairs aspects of cognitive function but does not alter plaque load in plaque-forming transgenic animals.
22728374 After optic nerve crush injury, transgenic NgR1-deficient neurons regenerate retinal ganglion axons as extensively as do zymosan-injected, macrophage-activated wild-type mice.
22133682 Nogo receptor 3, a paralog of NgR1,functions as a NgR1 co-receptor for Nogo-66.
21906273 These results indicate that a lack of NgR1/2 expression promotes the adhesion of DCs to myelin.
More...

AA Sequence

MKRASAGGSRLLAWVLWLQAWQVAAPCPGACVCYNEPKVTTSCPQQGLQAVPVGIPAASQRIFLHGNRIS      1 - 70
HVPAASFRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLRSVDPATFHGLGRLHTLHLDRC     71 - 140
GLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRDLGNLTHLFLHGNRISSVPERAFRGLHSLDRLLLH    141 - 210
QNRVAHVHPHAFRDLGRLMTLYLFANNLSALPTEALAPLRALQYLRLNDNPWVCDCRARPLWAWLQKFRG    211 - 280
SSSEVPCSLPQRLAGRDLKRLAANDLQGCAVATGPYHPIWTGRATDEEPLGLPKCCQPDAADKASVLEPG    281 - 350
RPASAGNALKGRVPPGDSPPGNGSGPRHINDSPFGTLPGSAEPPLTAVRPEGSEPPGFPTSGPRRRPGCS    351 - 420
RKNRTRSHCRLGQAGSGGGGTGDSEGSGALPSLTCSLTPLGLALVLWTVLGPC                     421 - 473
//

Text Mined References (64)

PMID Year Title
26083872 2015 A common functional allele of the Nogo receptor gene, reticulon 4 receptor (RTN4R), is associated with sporadic amyotrophic lateral sclerosis in a French population.
25666623 2015 LINGO-1 protein interacts with the p75 neurotrophin receptor in intracellular membrane compartments.
24956133 2014 Structural features of the Nogo receptor signaling complexes at the neuron/myelin interface.
24922571 2014 The Nogo receptor NgR1 mediates infection by mammalian reovirus.
24321711 2014 White matter abnormalities in 22q11.2 deletion syndrome: preliminary associations with the Nogo-66 receptor gene and symptoms of psychosis.
23982337 2013 RNA interference suppression of Nogo-66 receptor prevents Nogo-66-mediated inhibition of invasion and adhesion and simultaneously increases cell apoptosis in C6 cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22903127 2013 Neuronal overexpression of Nogo receptor 1 in APPswe/PSEN1(?E9) mice impairs spatial cognition tasks without influencing plaque formation.
22728374 2012 Axonal regeneration induced by blockade of glial inhibitors coupled with activation of intrinsic neuronal growth pathways.
More...