Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.45
PubTator Score 2.80

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BZQ6 B2RCH6 B7ZLZ2 Q0VGM5 Q5TEZ0 Q7L2Y5 Q9HCW1 Q9UFV7
Symbols C1orf22

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
22190034 HIV-1 gp120 is identified to have a physical interaction with ER degradation enhancer, mannosidase alpha-like 3 (EDEM3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MSEAGGRGCGSPVPQRARWRLVAATAAFCLVSATSVWTAGAEPMSREEKQKLGNQVLEMFDHAYGNYMEH      1 - 70
AYPADELMPLTCRGRVRGQEPSRGDVDDALGKFSLTLIDSLDTLVVLNKTKEFEDAVRKVLRDVNLDNDV     71 - 140
VVSVFETNIRVLGGLLGGHSLAIMLKEKGEYMQWYNDELLQMAKQLGYKLLPAFNTTSGLPYPRINLKFG    141 - 210
IRKPEARTGTETDTCTACAGTLILEFAALSRFTGATIFEEYARKALDFLWEKRQRSSNLVGVTINIHTGD    211 - 280
WVRKDSGVGAGIDSYYEYLLKAYVLLGDDSFLERFNTHYDAIMRYISQPPLLLDVHIHKPMLNARTWMDA    281 - 350
LLAFFPGLQVLKGDIRPAIETHEMLYQVIKKHNFLPEAFTTDFRVHWAQHPLRPEFAESTYFLYKATGDP    351 - 420
YYLEVGKTLIENLNKYARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLYLLFADKEDIIFDIEDYIFT    421 - 490
TEAHLLPLWLSTTNQSISKKNTTSEYTELDDSNFDWTCPNTQILFPNDPLYAQSIREPLKNVVDKSCPRG    491 - 560
IIRVEESFRSGAKPPLRARDFMATNPEHLEILKKMGVSLIHLKDGRVQLVQHAIQAASSIDAEDGLRFMQ    561 - 630
EMIELSSQQQKEQQLPPRAVQIVSHPFFGRVVLTAGPAQFGLDLSKHKETRGFVASSKPSNGCSELTNPE    631 - 700
AVMGKIALIQRGQCMFAEKARNIQNAGAIGGIVIDDNEGSSSDTAPLFQMAGDGKDTDDIKIPMLFLFSK    701 - 770
EGSIILDAIREYEEVEVLLSDKAKDRDPEMENEEQPSSENDSQNQSGEQISSSSQEVDLVDQESSEENSL    771 - 840
NSHPESLSLADMDNAASISPSEQTSNPTENHETTNLNGECTDLDNQLQEQSETEEDSNPNVSWGKKVQPI    841 - 910
DSILADWNEDIEAFEMMEKDEL                                                    911 - 932
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25092655 2014 EDEM2 initiates mammalian glycoprotein ERAD by catalyzing the first mannose trimming step.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18303019 2008 Getting in and out from calnexin/calreticulin cycles.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17499246 2007 Glycoprotein folding and the role of EDEM1, EDEM2 and EDEM3 in degradation of folding-defective glycoproteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...