Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.23
PubTator Score 2.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Breast cancer 2.300 2.7e-02
diabetes mellitus -1.300 3.4e-03
hepatocellular carcinoma 1.200 1.4e-05
intraductal papillary-mucinous adenoma (... 1.900 1.2e-02
intraductal papillary-mucinous carcinoma... 1.600 1.2e-02
intraductal papillary-mucinous neoplasm ... 1.700 2.3e-02
lung adenocarcinoma 1.268 7.0e-05
osteosarcoma 3.490 8.2e-08
ovarian cancer 2.900 2.6e-06
pancreatic cancer 1.200 1.6e-03
pancreatic carcinoma 1.200 1.6e-03
psoriasis 1.100 1.4e-05
Rheumatoid arthritis 1.800 1.2e-02
tuberculosis and treatment for 3 months -1.100 3.1e-04

Gene RIF (3)

AA Sequence

MSEAGGRGCGSPVPQRARWRLVAATAAFCLVSATSVWTAGAEPMSREEKQKLGNQVLEMFDHAYGNYMEH      1 - 70
AYPADELMPLTCRGRVRGQEPSRGDVDDALGKFSLTLIDSLDTLVVLNKTKEFEDAVRKVLRDVNLDNDV     71 - 140
VVSVFETNIRVLGGLLGGHSLAIMLKEKGEYMQWYNDELLQMAKQLGYKLLPAFNTTSGLPYPRINLKFG    141 - 210
IRKPEARTGTETDTCTACAGTLILEFAALSRFTGATIFEEYARKALDFLWEKRQRSSNLVGVTINIHTGD    211 - 280
WVRKDSGVGAGIDSYYEYLLKAYVLLGDDSFLERFNTHYDAIMRYISQPPLLLDVHIHKPMLNARTWMDA    281 - 350
LLAFFPGLQVLKGDIRPAIETHEMLYQVIKKHNFLPEAFTTDFRVHWAQHPLRPEFAESTYFLYKATGDP    351 - 420
YYLEVGKTLIENLNKYARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLYLLFADKEDIIFDIEDYIFT    421 - 490
TEAHLLPLWLSTTNQSISKKNTTSEYTELDDSNFDWTCPNTQILFPNDPLYAQSIREPLKNVVDKSCPRG    491 - 560
IIRVEESFRSGAKPPLRARDFMATNPEHLEILKKMGVSLIHLKDGRVQLVQHAIQAASSIDAEDGLRFMQ    561 - 630
EMIELSSQQQKEQQLPPRAVQIVSHPFFGRVVLTAGPAQFGLDLSKHKETRGFVASSKPSNGCSELTNPE    631 - 700
AVMGKIALIQRGQCMFAEKARNIQNAGAIGGIVIDDNEGSSSDTAPLFQMAGDGKDTDDIKIPMLFLFSK    701 - 770
EGSIILDAIREYEEVEVLLSDKAKDRDPEMENEEQPSSENDSQNQSGEQISSSSQEVDLVDQESSEENSL    771 - 840
NSHPESLSLADMDNAASISPSEQTSNPTENHETTNLNGECTDLDNQLQEQSETEEDSNPNVSWGKKVQPI    841 - 910
DSILADWNEDIEAFEMMEKDEL                                                    911 - 932
//

Text Mined References (20)

PMID Year Title