Property Summary

NCBI Gene PubMed Count 28
Grant Count 3
R01 Count 3
Funding $434,372.5
PubMed Score 30.97
PubTator Score 17.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -2.300 0.000
astrocytoma -2.300 0.013
ependymoma -2.000 0.000
glioblastoma -3.300 0.000
oligodendroglioma -1.600 0.000
osteosarcoma -2.295 0.000
group 3 medulloblastoma -2.700 0.001
cystic fibrosis 2.009 0.000
atypical teratoid / rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell -2.100 0.003
primitive neuroectodermal tumor -1.200 0.014
fibroadenoma -1.100 0.008
adult high grade glioma -2.800 0.000
pilocytic astrocytoma -2.200 0.000
subependymal giant cell astrocytoma -4.159 0.004
lung carcinoma 2.600 0.000
Pick disease -2.100 0.010
ductal carcinoma in situ -1.800 0.001
invasive ductal carcinoma -1.800 0.010
ovarian cancer -1.500 0.000
Down syndrome -1.100 0.048

Synonym

Gene

PANTHER Protein Class (2)

Gene RIF (14)

PMID Text
24840802 Nicotinamide mononucleotide adenylyltransferase 2 (NMNAT2) is essential for axon growth and survival.
24552824 Knockdown of NMNAT-2 significantly reduces cellular NAD(+) levels and protects cells from p53-dependent cell death upon DNA damage, suggesting an important functional role of NMNAT-2 in p53-mediated signaling.
23764899 Overexpression of NMNAT2 in colorectal cancer cells renders them sensitive to Tiazofurin antineoplastic action.
23579329 affects tau phosphorylation by regulating PP2A activity
22027994 Decreased endogenous NMNAT2 function caused by reduced CREB signaling during pathological insults may be one of underlying mechanisms for neuronal death in tauopathies
20962850 Observational study of gene-disease association. (HuGE Navigator)
20943658 Nmnat2 is a neuronal protein peripherally attached to membranes via palmitoylation and suggest that Nmnat2 is transported to synaptic terminals via an endosomal pathway.
20857515 that overexpression of Nmnat2 in M-cells significantly delayed axon degeneration in vivo
20388704 analysis of isoform-specific targeting and interaction domains in human nicotinamide mononucleotide adenylyltransferases
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MTETTKTHVILLACGSFNPITKGHIQMFERARDYLHKTGRFIVIGGIVSPVHDSYGKQGLVSSRHRLIMC      1 - 70
QLAVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTPSMTPVIGQPQNETPQPIYQN     71 - 140
SNVATKPTAAKILGKVGESLSRICCVRPPVERFTFVDENANLGTVMRYEEIELRILLLCGSDLLESFCIP    141 - 210
GLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHG    211 - 280
DGHVVDYLSQPVIDYILKSQLYINASG                                               281 - 307
//

Text Mined References (28)

PMID Year Title
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24840802 2014 Wallerian degeneration: an emerging axon death pathway linking injury and disease.
24552824 2014 The NAD+ synthesizing enzyme nicotinamide mononucleotide adenylyltransferase 2 (NMNAT-2) is a p53 downstream target.
23764899 2013 Nicotinamide mononucleotide adenylyltransferase2 overexpression enhances colorectal cancer cell-kill by Tiazofurin.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
23579329 2013 Nmnat2 attenuates Tau phosphorylation through activation of PP2A.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22027994 2012 CREB-activity and nmnat2 transcription are down-regulated prior to neurodegeneration, while NMNAT2 over-expression is neuroprotective, in a mouse model of human tauopathy.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20954240 2010 Homology modeling and deletion mutants of human nicotinamide mononucleotide adenylyltransferase isozyme 2: new insights on structure and function relationship.
More...