Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.33
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BZQ2 Q4G195 Q9BZQ3 Q9H2B6
Symbols GE36
C1orf14

Gene

Gene RIF (1)

PMID Text
24557841 SHCBP1L is a conserved mammalian protein predominantly expressed in male germ cells and it maintains spindle stability during meiosis in testis.

AA Sequence

MRPQDPALYPQAPHPLALGRASHPSQSRNTPPAGRPRAAARCGPERRAPIGQSGRGREKWPTAASALGLL      1 - 70
RRWRRASKASVPADSFRTISPDRRGEKSASAVSGDTAAATTLKGTAIPVRSVVASPRPVKGKAGRETARL     71 - 140
RLQRLPAAQAEDTGEAAAAAAEEPLLPVPEDEEEAQPLPPVCVSRMRGMWRDEKVSLYCDEVLQDCKAED    141 - 210
ADEVMGKYLSEKLKLKDKWLGVWKTNPSVFFVKYEEASIPFVGILVEVTCEPYQDSSSRFKVTVSVAEPF    211 - 280
SSNIANIPRDLVDEILEELEHSVPLLEVYPVEGQDTDIHVIALALEVVRFFYDFLWRDWDDEESCENYTA    281 - 350
LIEERINLWCDIQDGTIPGPIAQRFKKTLEKYKNKRVELIEYQSNIKEDPSAAEAVECWKKYYEIVMLCG    351 - 420
LLKMWEDLRLRVHGPFFPRILRRRKGKREFGKTITHIVAKMMTTEMIKDLSSDTLLQQHGDLDLALDNCY    421 - 490
SGDTVIIFPGEYQAANLALLTDDIIIKGVGKREEIMITSEPSRDSFVVSKADNVKLMHLSLIQQGTVDGI    491 - 560
VVVESGHMTLENCILKCEGTGVCVLTGAALTITDSEITGAQGAGVELYPGSIAILERNEIHHCNNLRTSN    561 - 630
SSKSTLGGVNMKVLPAPKLKMTNNHIYSNKGYGVSILQPMEQFFIVAEEALNKRASSGDKKDDKMLFKVM    631 - 700
QNLNLEMNNNKIEANVKGDIRIVTS                                                 701 - 725
//

Text Mined References (6)

PMID Year Title
24557841 2014 SHCBP1L, a conserved protein in mammals, is predominantly expressed in male germ cells and maintains spindle stability during meiosis in testis.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11318611 2001 Cloning and characterization of 13 novel transcripts and the human RGS8 gene from the 1q25 region encompassing the hereditary prostate cancer (HPC1) locus.