Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

Synonym

Accession Q9BZP3 Q9BZP2 Q9BZP4
Symbols C18orf2

Gene

 Compartment GO Term (0)

AA Sequence

MVRHPYSVQTQLSTEAKAIWRSMQQQETNLLANLTTNDARDNSKDFQNSKVGAAATSRDEGCNCPIIGEI      1 - 70
VISCYWLFEIPPLISE                                                           71 - 86
//

Text Mined References (2)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11173868 2000 EST mining of the UniGene dataset to identify retina-specific genes.