Property Summary

NCBI Gene PubMed Count 51
PubMed Score 53.41
PubTator Score 40.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 1.946 2.0e-03
astrocytic glioma -1.400 4.2e-03
Astrocytoma, Pilocytic -1.200 3.6e-04
atypical teratoid / rhabdoid tumor -1.300 7.5e-04
Breast cancer 1.200 1.4e-02
cystic fibrosis -1.047 3.4e-05
ductal carcinoma in situ 1.200 4.6e-02
ependymoma -1.400 5.1e-03
esophageal adenocarcinoma -1.400 2.0e-02
intraductal papillary-mucinous carcinoma... 1.800 7.0e-03
intraductal papillary-mucinous neoplasm ... 3.500 4.9e-06
malignant mesothelioma -2.900 3.7e-08
medulloblastoma, large-cell -1.900 8.2e-07
non-small cell lung cancer 1.531 1.6e-11
oligodendroglioma -1.400 4.2e-03
osteosarcoma 2.022 7.4e-03
pancreatic cancer 1.700 2.0e-05
psoriasis 1.100 8.5e-10
tuberculosis -1.900 2.4e-04

Gene RIF (53)

AA Sequence

MAAAAATKILLCLPLLLLLSGWSRAGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKT      1 - 70
VTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQ     71 - 140
FSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAG    141 - 210
APLAMSSGTTQLRATATTLILCCLLIILPCFILPGI                                      211 - 246
//

Text Mined References (52)

PMID Year Title