Property Summary

NCBI Gene PubMed Count 48
Grant Count 7
R01 Count 5
Funding $495,500.68
PubMed Score 49.23
PubTator Score 40.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (65)

PMID Text
26805759 By suppressing AR and up-regulating ULBP2 in HCC, cisplatin could up-regulate cytotoxicity of NK cells to better target HCC.
25995251 Varicella-Zoster Virus differentially modulates expression of the NKG2D ligands by upregulating MICA expression and reducing ULBP2 and ULBP3 expression in the infected cells.
25983110 A conserved WW domain-like motif regulates CD74 antigen-dependent cell-surface transport of the NKG2D ligand ULBP2.
25807049 HIV-1 Vpr from most HIV-1 primary isolates can upregulate ULBP2 expression and induce NKG2D-dependent NK cell killing
25775242 This study suggests that NKG2D ligands shedding of MICA, MICB and ULBP-2 is a novel pathway in endometriosis complex pathogenesis that impairs Natural Killer Cells cell function.
25687758 Data inticate that heat shock protein 60 (HSP60) interacted constitutively with NKG2D ligand ULBP2 and phosphatase of regenerating liver 3 (PRL-3) regulated HSP60 tyrosine phosphorylation.
25634359 NKG2D and NKG2DL are involved in allergen-induced activation of dendritic epidermal T cells and the NKG2D/NKG2DL pathway might be a potential target for treatment of contact hypersensitivity.
25212604 Human anaplastic thyroid carcinoma cells are sensitive to NK cell-mediated lysis via ULBP2/5/6 and chemoattract NK cells.
25024379 the NKG2D ligand ULBP2 is transported to the cell surface through an endosomal pathway dependent on protein kinase C and lysosomal integrity. ULBP2 surface transport is dependent on the invariant chain.
24846123 c-Cbl regulates MICA- but not ULBP2-induced NKG2D down-modulation in human NK cells.
More...

AA Sequence

MAAAAATKILLCLPLLLLLSGWSRAGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKT      1 - 70
VTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQ     71 - 140
FSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAG    141 - 210
APLAMSSGTTQLRATATTLILCCLLIILPCFILPGI                                      211 - 246
//

Text Mined References (49)

PMID Year Title
26805759 2016 Cisplatin enhances NK cells immunotherapy efficacy to suppress HCC progression via altering the androgen receptor (AR)-ULBP2 signals.
26190895 2015 Effect of Clarithromycin on the Expression of UL16-Binding Protein 2 in Human Cells.
25995251 2015 Varicella-Zoster Virus and Herpes Simplex Virus 1 Differentially Modulate NKG2D Ligand Expression during Productive Infection.
25983110 2015 A conserved WW domain-like motif regulates invariant chain-dependent cell-surface transport of the NKG2D ligand ULBP2.
25775242 2015 Soluble ligands for the NKG2D receptor are released during endometriosis and correlate with disease severity.
25687758 2015 PRL-3 mediates the protein maturation of ULBP2 by regulating the tyrosine phosphorylation of HSP60.
25634359 2015 NKG2D-dependent activation of dendritic epidermal T cells in contact hypersensitivity.
25212604 2014 Human anaplastic thyroid carcinoma cells are sensitive to NK cell-mediated lysis via ULBP2/5/6 and chemoattract NK cells.
25024379 2014 The NKG2D ligand ULBP2 is specifically regulated through an invariant chain-dependent endosomal pathway.
24846123 2014 c-Cbl regulates MICA- but not ULBP2-induced NKG2D down-modulation in human NK cells.
More...