Property Summary

NCBI Gene PubMed Count 25
PubMed Score 21.70
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Alopecia areata 41 4.39 2.2
Type 2 diabetes mellitus 272 0.0 0.7
Disease Target Count Z-score Confidence
Telogen effluvium 4 3.868 1.9

Expression

Gene RIF (18)

AA Sequence

MAAAASPAILPRLAILPYLLFDWSGTGRADAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSD      1 - 70
KVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSW     71 - 140
QFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTA    141 - 210
PPTMAPGLAQPKAIATTLSPWSFLIILCFILPGI                                        211 - 244
//

Text Mined References (29)

PMID Year Title