Property Summary

NCBI Gene PubMed Count 23
Grant Count 7
Funding $481,393.13
PubMed Score 21.49
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (27)

PMID Text
25995251 Varicella-Zoster Virus differentially modulates expression of the NKG2D ligands by upregulating MICA expression and reducing ULBP2 and ULBP3 expression in the infected cells.
24677544 This study provides for the first time, the c-Myc dependent regulation of NKG2D ligands, ULBP1/2/3 in acute myeloid leukemia.
21934670 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
21934670 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
21934670 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
21934670 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
21934670 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
21874023 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
21874023 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
21874023 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
More...

AA Sequence

MAAAASPAILPRLAILPYLLFDWSGTGRADAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSD      1 - 70
KVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSW     71 - 140
QFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTA    141 - 210
PPTMAPGLAQPKAIATTLSPWSFLIILCFILPGI                                        211 - 244
//

Text Mined References (27)

PMID Year Title
25995251 2015 Varicella-Zoster Virus and Herpes Simplex Virus 1 Differentially Modulate NKG2D Ligand Expression during Productive Infection.
25980678 2015 Transfer of the human NKG2D ligands UL16 binding proteins (ULBP) 1-3 is related to lytic granule release and leads to ligand retransfer and killing of ULBP-recipient natural killer cells.
25138242 2014 The regulatory effect of UL-16 binding protein-3 expression on the cytotoxicity of NK cells in cancer patients.
24677544 2014 c-Myc regulates expression of NKG2D ligands ULBP1/2/3 in AML and modulates their susceptibility to NK-mediated lysis.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21689246 Treatment of alopecia areata: "What is new on the horizon?".
21320692 2011 An identical miRNA of the human JC and BK polyoma viruses targets the stress-induced ligand ULBP3 to escape immune elimination.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20596022 2010 Genome-wide association study in alopecia areata implicates both innate and adaptive immunity.
More...