Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.42
PubTator Score 3.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Synonym

Accession Q9BZM2 Q5R385 Q8N217 Q9H506 GIIF sPLA2
Symbols

Gene

PANTHER Protein Class (3)

Gene RIF (6)

PMID Text
24269828 two of these isoforms, sPLA2 IIA and sPLA2 IIF, localize to the upper stratum granulosum and increase in response to experimental barrier perturbation.
22082156 Knockdown of phospholipase A2, group IIF (PLA2G2F) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
9745929 HIV-1 gp120 induces a specific phospholipase A2 (PLA2) activation in lymphocytes through binding to CD4, but this effect is not sufficient to accomplish virus/cell fusion
9745929 HIV-1 gp120 induces a specific phospholipase A2 (PLA2) activation in lymphocytes through binding to CD4, but this effect is not sufficient to accomplish virus/cell fusion
9377118 HIV-1 gp120 induces a specific phospholipase A2 (PLA2) activation in lymphocytes through binding to CD4, but this effect is not sufficient to accomplish virus/cell fusion

AA Sequence

MKKFFTVAILAGSVLSTAHGSLLNLKAMVEAVTGRSAILSFVGYGCYCGLGGRGQPKDEVDWCCHAHDCC      1 - 70
YQELFDQGCHPYVDHYDHTIENNTEIVCSDLNKTECDKQTCMCDKNMVLCLMNQTYREEYRGFLNVYCQG     71 - 140
PTPNCSIYEPPPEEVTCSHQSPAPPAPP                                              141 - 168
//

Text Mined References (6)

PMID Year Title
24269828 2014 sPLA2 and the epidermal barrier.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11877435 2002 Cellular arachidonate-releasing function and inflammation-associated expression of group IIF secretory phospholipase A2.
11112443 2000 Cloning and recombinant expression of human group IIF-secreted phospholipase A(2).