Property Summary

NCBI Gene PubMed Count 14
PubMed Score 27.12
PubTator Score 7.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.100 1.2e-03
hepatocellular carcinoma 1.100 2.8e-04
lung cancer 1.900 1.6e-03
malignant mesothelioma -1.200 2.3e-06
osteosarcoma -1.077 7.8e-06
ovarian cancer -1.400 6.7e-05
pancreatic cancer 1.700 3.5e-04
pancreatic carcinoma 1.700 3.5e-04
pancreatic ductal adenocarcinoma liver m... -1.557 8.8e-03
ulcerative colitis -1.500 1.8e-06

Protein-protein Interaction (1)

Gene RIF (8)

AA Sequence

MALLSRPALTLLLLLMAAVVRCQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDG      1 - 70
SKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQ     71 - 140
KTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL                         141 - 189
//

Text Mined References (14)

PMID Year Title