Property Summary

NCBI Gene PubMed Count 13
PubMed Score 24.65
PubTator Score 7.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Age related macular degeneration 84
Disease Target Count P-value
ovarian cancer 8492 5.8327524651861E-11
ulcerative colitis 2087 1.79030314824844E-6
malignant mesothelioma 3163 2.27590790336069E-6
osteosarcoma 7933 7.79242151952904E-6
hepatocellular carcinoma 550 2.79928514252391E-4
pancreatic cancer 2300 3.54299305533421E-4
pancreatic carcinoma 567 3.54299305533424E-4
gastric cancer 436 0.00116434766337878
lung cancer 4473 0.0016183348153973
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00878129549326568
Disease Target Count Z-score Confidence
Eye disease 55 0.0 2.0

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.100 0.001
hepatocellular carcinoma 1.100 0.000
pancreatic cancer 1.700 0.000
malignant mesothelioma -1.200 0.000
osteosarcoma -1.077 0.000
pancreatic ductal adenocarcinoma liver m... -1.557 0.009
lung cancer 1.900 0.002
pancreatic carcinoma 1.700 0.000
ulcerative colitis -1.500 0.000
ovarian cancer -2.600 0.000

Synonym

Accession Q9BZM1 Q9BZ89 GXII sPLA2
Symbols GXII
ROSSY
PLA2G12

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20332099 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
12522102 cellular arachidonate (AA) release and prostaglandin (PG) production are regulated by novel classes of secretory phospholipase A(2)s (sPLA(2)s), groups III and XII
9745929 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor
9377118 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor

AA Sequence

MALLSRPALTLLLLLMAAVVRCQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDG      1 - 70
SKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQ     71 - 140
KTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL                         141 - 189
//

Text Mined References (13)

PMID Year Title
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20385819 2010 Genetic variants near TIMP3 and high-density lipoprotein-associated loci influence susceptibility to age-related macular degeneration.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14516201 2003 Novel mammalian group XII secreted phospholipase A2 lacking enzymatic activity.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12522102 2003 Cellular arachidonate-releasing function of novel classes of secretory phospholipase A2s (groups III and XII).
More...