Property Summary

NCBI Gene PubMed Count 58
Grant Count 6
Funding $161,363.6
PubMed Score 34.28
PubTator Score 24.90

Knowledge Summary

Patent (10,073)

Expression

Synonym

Accession Q9BZL6 M0R2R2 Q8NCK8 Q8TB08 Q9P0T6 Q9Y3X8
Symbols PKD2
HSPC187
nPKC-D2

Gene

PDB

2COA   3BGM   4NNX   4NNY  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (40)

PMID Text
26253275 Studies indicate that the loss of protein kinase D PKD1 is thought to promote invasion and metastasis, while PKD2 and upregulated PKD3 to be positive regulators of proliferation.
26241492 the knockdown of PKD2 reduces cell death and promotes polyploidization induced by PMA. PMA/PKD2-mediated necrosis via PARP cleavage involves both SOD1-dependent and -independent pathways.
25874490 The results implied that PKD2 silencing might inhibit migration of MCF7/DOX cells without affecting chemoresistance significantly
25802335 Loss of PKD2 enhanced KC proliferative potential while loss of PKD3 resulted in a progressive proliferation defect, loss of clonogenicity and diminished tissue regenerative ability.
25218347 Both PKD2 and GOLPH3 play important roles in the progression of human gliomas by promoting cell proliferation.
24840177 Activation of PKD2 and further increase of PKD3 activity leads to additional phosphorylation and inhibition of endogenous phosphatase slingshot 1L.
24463355 PRKD2 silencing induces glioma cell senescence via p53-dependent and -independent pathways.
24336522 PKD2 controls secretion of MMP7 and 9 in an isoform-specific manner
23562655 PRKD2 is a potential target to interfere with glioblastoma cell migration and invasion, two major determinants contributing to recurrence of glioblastoma after multimodality treatment.
23515950 PRKD2 mediates BAZF gene expression by VEGF-A stimulation.
More...

AA Sequence

MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLLPAASELAHVK      1 - 70
QLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDLVEVVLSASATFEDFQIRPHA     71 - 140
LTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLG    141 - 210
TSESLPCTAEELSRSTTELLPRRPPSSSSSSSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQA    211 - 280
CKKLLKGLFRQGLQCKDCKFNCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVI    281 - 350
PGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR    351 - 420
LDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPS    421 - 490
GQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQENVDIATVYQIFPDEVLGSG    491 - 560
QFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVAILQSLRHPGIVNLECMFETPEKVFVVMEKL    561 - 630
HGDMLEMILSSEKGRLPERLTKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFAR    631 - 700
IIGEKSFRRSVVGTPAYLAPEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPA    701 - 770
SPWSHISAGAIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDVRWEQF    771 - 840
AAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL                                    841 - 878
//

Text Mined References (74)

PMID Year Title
26253275 2015 Functional and therapeutic significance of protein kinase D enzymes in invasive breast cancer.
26241492 2015 Down-regulation of superoxide dismutase 1 by PMA is involved in cell fate determination and mediated via protein kinase D2 in myeloid leukemia cells.
25874490 2015 Protein kinase D2 silencing reduced motility of doxorubicin-resistant MCF7 cells.
25802335 2015 Opposing growth regulatory roles of protein kinase D isoforms in human keratinocytes.
25218347 2014 Protein kinase D2 promotes the proliferation of glioma cells by regulating Golgi phosphoprotein 3.
24840177 2014 Protein kinase d isoforms differentially modulate cofilin-driven directed cell migration.
24463355 2014 Silencing of protein kinase D2 induces glioma cell senescence via p53-dependent and -independent pathways.
24336522 2014 Protein kinase D2 induces invasion of pancreatic cancer cells by regulating matrix metalloproteinases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23562655 2013 Protein kinase D2 regulates migration and invasion of U87MG glioblastoma cells in vitro.
More...