Property Summary

NCBI Gene PubMed Count 58
PubMed Score 34.28
PubTator Score 24.90

Knowledge Summary

Patent (10,073)

Expression

  Differential Expression (15)

Disease log2 FC p
Multiple myeloma 1.963 1.0e-03
ependymoma 1.600 5.1e-03
glioblastoma multiforme 1.200 1.2e-21
osteosarcoma -1.796 1.5e-04
astrocytoma 1.100 1.8e-02
atypical teratoid / rhabdoid tumor 1.400 2.6e-06
primitive neuroectodermal tumor 1.200 5.4e-03
juvenile dermatomyositis -1.204 6.7e-11
pancreatic ductal adenocarcinoma liver m... 1.427 3.9e-02
pediatric high grade glioma 1.100 1.6e-05
sonic hedgehog group medulloblastoma 1.200 2.9e-05
non primary Sjogren syndrome sicca 1.100 1.4e-02
subependymal giant cell astrocytoma 1.161 2.0e-02
spina bifida 1.251 3.6e-02
ovarian cancer 1.500 2.3e-06

Protein-protein Interaction (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (40)

PMID Text
26253275 Studies indicate that the loss of protein kinase D PKD1 is thought to promote invasion and metastasis, while PKD2 and upregulated PKD3 to be positive regulators of proliferation.
26241492 the knockdown of PKD2 reduces cell death and promotes polyploidization induced by PMA. PMA/PKD2-mediated necrosis via PARP cleavage involves both SOD1-dependent and -independent pathways.
25874490 The results implied that PKD2 silencing might inhibit migration of MCF7/DOX cells without affecting chemoresistance significantly
25802335 Loss of PKD2 enhanced KC proliferative potential while loss of PKD3 resulted in a progressive proliferation defect, loss of clonogenicity and diminished tissue regenerative ability.
25218347 Both PKD2 and GOLPH3 play important roles in the progression of human gliomas by promoting cell proliferation.
24840177 Activation of PKD2 and further increase of PKD3 activity leads to additional phosphorylation and inhibition of endogenous phosphatase slingshot 1L.
24463355 PRKD2 silencing induces glioma cell senescence via p53-dependent and -independent pathways.
24336522 PKD2 controls secretion of MMP7 and 9 in an isoform-specific manner
23562655 PRKD2 is a potential target to interfere with glioblastoma cell migration and invasion, two major determinants contributing to recurrence of glioblastoma after multimodality treatment.
23515950 PRKD2 mediates BAZF gene expression by VEGF-A stimulation.
23393329 We have identified PKD2 and PKD3, especially PKD3, as novel cell growth regulators in HCC1806 triple-negative breast cancer cells
23251465 results suggest that PKD2 is involved in the regulation of PP2A activity in activated T cells through phosphorylation of Ser171 of SET
22734003 found that AMAP1 had the ability to bind directly to PRKD2 and hence to make a complex with the cytoplasmic tail of the beta1 subunit
22217708 upregulation of PKD2 expression may determine the behavior of gastric tumor cells, which promotes invasive phenotype and could result in general poor prognosis.
21865166 Tyrosine phosphorylation of PKD2 is required for IFNalpha-stimulated activation of this kinase as well as for efficient serine phosphorylation and degradation of IFNAR1 and ensuing restriction of the extent of cellular responses to IFNalpha.
21736870 PKD2 is a common signaling target downstream of various agonist receptors in platelets and G(q)-mediated signals along with calcium and novel PKC isoforms, in particular, PKCdelta activate PKD2 in platelets.
21173164 Expression and kinase activity of PKD2 are required for the ligand-inducible stimulation of IFNAR1 ubiquitination and endocytosis and for accelerated proteolytic turnover of IFNAR1.
20855867 Observational study of gene-disease association. (HuGE Navigator)
20732914 PKD2 regulates hypoxia-induced VEGF-A expression/secretion by tumour cells and VEGF-A stimulated blood vessel formation and a essential mediator of tumour cell-endothelial cell communication and a target to inhibit angiogenesis in gastrointestinal cancers
20731705 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20553269 Observational study of gene-disease association. (HuGE Navigator)
20332261 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19581308 a transient association of PKD1 and PKD2 with NHERF-1 in live cells that is triggered by phorbol ester stimulation and, importantly, differs strikingly from the sustained translocation to plasma membrane.
19520973 Lysophosphatidylcholine activates a novel PKD2-mediated signaling pathway that controls monocyte migration.
19192391 Lck regulated the activity of PKD2 by tyrosine phosphorylation, which in turn may have modulated the physiological functions of PKD2 during T cell receptor-induced T cell activation.
19001381 PKD2 plays a pivotal role in endothelial cell proliferation and migration necessary for angiogenesis at least in part through modulation of the expression of vascular endothelial growth factor receptor-2 and fibroblast growth factor receptor-1
18758461 Genome-wide association study of gene-disease association. (HuGE Navigator)
18262756 expression and catalytic activity of PKD2 are required for the release of chromogranin A containing secretory vesicles
17962809 Signal transduction pathway is defined downstream of CCK2 receptor showing that CK1 delta and epsilon phosphorylate PKD2 at 3 sites, resulting in nuclear accumulation of PKD2 and phosphorylation of nuclear PKD2 substrates in human gastric cancer cells.
17951978 stimulation of P-selectin surface expression via PKCalpha-dependent PKD2 activation could be an important mechanism in the early onset of AII-initiated endothelial adhesiveness
17570131 Neurotensin induces a striking increase in Hsp27 phosphorylation on Ser-82 in PANC-1 cells through convergent p38 MAPK, PKD, and PKD2 signaling.
17077180 The data suggest that PKD2 is involved in IL-2 promoter regulation and cell death depending on its activity upon TCR stimulation in Jurkat cells.
16928771 PKD2 is involved in the production of IL-8, a potent proinflammatory chemokine, by epithelial cells.
16899224 PKD2 plays an important role in carcinoid tumor progression.
15975900 Critical components of the PKD2 regulatory domain control phorbol ester binding, catalytic activity, and nucleocytoplasmic shuttling and reveal similarities but also striking differences compared to the published data for this domain in PKD1.
15604256 Data show that Bcr-Abl-induced activation of the nuclear factor kappaB cascade in myeloid leukemia cells is largely mediated by tyrosine-phosphorylated PKD2.
14743217 specificity of different PKD isoforms in regulating protein trafficking from the trans-Golgi network
12058027 mechanism of activation by CCK(B)/gastrin receptor

AA Sequence

MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLLPAASELAHVK      1 - 70
QLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDLVEVVLSASATFEDFQIRPHA     71 - 140
LTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLG    141 - 210
TSESLPCTAEELSRSTTELLPRRPPSSSSSSSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQA    211 - 280
CKKLLKGLFRQGLQCKDCKFNCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVI    281 - 350
PGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR    351 - 420
LDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPS    421 - 490
GQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQENVDIATVYQIFPDEVLGSG    491 - 560
QFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVAILQSLRHPGIVNLECMFETPEKVFVVMEKL    561 - 630
HGDMLEMILSSEKGRLPERLTKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFAR    631 - 700
IIGEKSFRRSVVGTPAYLAPEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPA    701 - 770
SPWSHISAGAIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDVRWEQF    771 - 840
AAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL                                    841 - 878
//

Text Mined References (74)

PMID Year Title
26253275 2015 Functional and therapeutic significance of protein kinase D enzymes in invasive breast cancer.
26241492 2015 Down-regulation of superoxide dismutase 1 by PMA is involved in cell fate determination and mediated via protein kinase D2 in myeloid leukemia cells.
25874490 2015 Protein kinase D2 silencing reduced motility of doxorubicin-resistant MCF7 cells.
25802335 2015 Opposing growth regulatory roles of protein kinase D isoforms in human keratinocytes.
25218347 2014 Protein kinase D2 promotes the proliferation of glioma cells by regulating Golgi phosphoprotein 3.
24840177 2014 Protein kinase d isoforms differentially modulate cofilin-driven directed cell migration.
24463355 2014 Silencing of protein kinase D2 induces glioma cell senescence via p53-dependent and -independent pathways.
24336522 2014 Protein kinase D2 induces invasion of pancreatic cancer cells by regulating matrix metalloproteinases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23562655 2013 Protein kinase D2 regulates migration and invasion of U87MG glioblastoma cells in vitro.
23515950 2013 Protein kinase D2 and heat shock protein 90 beta are required for BCL6-associated zinc finger protein mRNA stabilization induced by vascular endothelial growth factor-A.
23503467 2014 A novel splice variant of calcium and integrin-binding protein 1 mediates protein kinase D2-stimulated tumour growth by regulating angiogenesis.
23393329 2013 Protein kinases D2 and D3 are novel growth regulators in HCC1806 triple-negative breast cancer cells.
23251465 2012 Phosphorylation of SET protein at Ser171 by protein kinase D2 diminishes its inhibitory effect on protein phosphatase 2A.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22734003 2012 Rab5c promotes AMAP1-PRKD2 complex formation to enhance ?1 integrin recycling in EGF-induced cancer invasion.
22228765 2012 Protein kinase D regulates RhoA activity via rhotekin phosphorylation.
22217708 2011 Differential expression of PKD1 and PKD2 in gastric cancer and analysis of PKD1 and PKD2 function in the model system.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21865166 2011 Tyrosine phosphorylation of protein kinase D2 mediates ligand-inducible elimination of the Type 1 interferon receptor.
21736870 2011 Protein kinase C? mediates the activation of protein kinase D2 in platelets.
21488147 2011 Protein kinase D in vascular biology and angiogenesis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21173164 2011 Ligand-stimulated downregulation of the alpha interferon receptor: role of protein kinase D2.
20855867 2010 Inherited genetic susceptibility to monoclonal B-cell lymphocytosis.
20732914 2010 Protein kinase D2 is a crucial regulator of tumour cell-endothelial cell communication in gastrointestinal tumours.
20731705 2010 Genetic susceptibility for chronic lymphocytic leukemia among Chinese in Hong Kong.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20553269 2010 Verification that common variation at 2q37.1, 6p25.3, 11q24.1, 15q23, and 19q13.32 influences chronic lymphocytic leukaemia risk.
20497126 2010 Characterization of the biological effects of a novel protein kinase D inhibitor in endothelial cells.
20332261 2010 Genetic susceptibility variants for chronic lymphocytic leukemia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19581308 2009 The protein scaffold NHERF-1 controls the amplitude and duration of localized protein kinase D activity.
19520973 2009 Lysophosphatidylcholine activates a novel PKD2-mediated signaling pathway that controls monocyte migration.
19430480 2009 Genome-wide association study and meta-analysis find that over 40 loci affect risk of type 1 diabetes.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19192391 2009 PKD2 interacts with Lck and regulates NFAT activity in T cells.
19001381 2009 Identification of protein kinase D2 as a pivotal regulator of endothelial cell proliferation, migration, and angiogenesis.
18836451 2008 Phosphorylation-dependent interaction between antigenic peptides and MHC class I: a molecular basis for the presentation of transformed self.
18758461 2008 A genome-wide association study identifies six susceptibility loci for chronic lymphocytic leukemia.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18440775 2008 Vascular endothelial growth factor induces heat shock protein (HSP) 27 serine 82 phosphorylation and endothelial tubulogenesis via protein kinase D and independent of p38 kinase.
18262756 2008 Protein kinase D2 regulates chromogranin A secretion in human BON neuroendocrine tumour cells.
18076381 2008 Selective binding of phorbol esters and diacylglycerol by individual C1 domains of the PKD family.
18059339 2008 The zinc-finger transcription factor, early growth response 3, mediates VEGF-induced angiogenesis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17962809 2007 Phosphorylation at Ser244 by CK1 determines nuclear localization and substrate targeting of PKD2.
17951978 2007 Angiotensin II directly triggers endothelial exocytosis via protein kinase C-dependent protein kinase D2 activation.
17570131 2008 PKD, PKD2, and p38 MAPK mediate Hsp27 serine-82 phosphorylation induced by neurotensin in pancreatic cancer PANC-1 cells.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
17121608 2006 Comparative mapping reveals multiple rearrangements between pig chromosome 6 and human 19q13.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17077180 2006 Protein kinase D2 contributes to either IL-2 promoter regulation or induction of cell death upon TCR stimulation depending on its activity in Jurkat cells.
16928771 2007 Protein kinase D2 mediates lysophosphatidic acid-induced interleukin 8 production in nontransformed human colonic epithelial cells through NF-kappaB.
16899224 2006 Overexpression of wild-type PKD2 leads to increased proliferation and invasion of BON endocrine cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
15975900 2005 Role of the regulatory domain of protein kinase D2 in phorbol ester binding, catalytic activity, and nucleocytoplasmic shuttling.
15623513 2005 Protein kinase D1 phosphorylates HDAC7 and induces its nuclear export after T-cell receptor activation.
15604256 2004 Protein kinase D2 mediates activation of nuclear factor kappaB by Bcr-Abl in Bcr-Abl+ human myeloid leukemia cells.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14743217 2004 Protein kinase D regulates basolateral membrane protein exit from trans-Golgi network.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12646243 2003 Intracellular redistribution of protein kinase D2 in response to G-protein-coupled receptor agonists.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12058027 2002 Mechanism of activation of protein kinase D2(PKD2) by the CCK(B)/gastrin receptor.
11062248 2001 Molecular cloning and characterization of the human protein kinase D2. A novel member of the protein kinase D family of serine threonine kinases.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.