Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.14
PubTator Score 1.51

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
11288140 Reports cloning of rat NID67 and discussion of mouse and human orthologs.

AA Sequence

MDAVSQVPMEVVLPKHILDIWVIVLIILATIVIMTSLLLCPATAVIIYRMRTHPILSGAV                1 - 60
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11288140 2001 NID67, a small putative membrane protein, is preferentially induced by NGF in PC12 pheochromocytoma cells.