Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.14
PubTator Score 1.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession Q9BZL3 Q3MIG3 Q6ZUV4
Symbols NID67
MST150
C5orf62

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MDAVSQVPMEVVLPKHILDIWVIVLIILATIVIMTSLLLCPATAVIIYRMRTHPILSGAV                1 - 60
//

Text Mined References (8)

PMID Year Title