Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.14
PubTator Score 1.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (1)

AA Sequence

MDAVSQVPMEVVLPKHILDIWVIVLIILATIVIMTSLLLCPATAVIIYRMRTHPILSGAV                1 - 60
//

Text Mined References (8)

PMID Year Title