Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.14
PubTator Score 1.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
glioblastoma multiforme 347 4.99995263824851E-19
pilocytic astrocytoma 3086 2.37932635415666E-8
lung adenocarcinoma 2714 6.23732985010527E-7
intraductal papillary-mucinous adenoma (IPMA) 2956 2.14702127916045E-5
ulcerative colitis 2087 5.19381337837118E-5
ovarian cancer 8492 1.18314664499599E-4
group 4 medulloblastoma 1875 6.57487794548247E-4
osteosarcoma 7933 0.00239909024322107
pediatric high grade glioma 2712 0.00248845871458119
invasive ductal carcinoma 2950 0.00559870833765595
medulloblastoma, large-cell 6234 0.00568101283725367
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.012315617807193
ductal carcinoma in situ 1745 0.0152665300594998
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0208168926266682
Disease Target Count Z-score Confidence
Thrombocytosis 8 3.073 1.5

Synonym

Accession Q9BZL3 Q3MIG3 Q6ZUV4
Symbols NID67
MST150
C5orf62

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG

Gene RIF (1)

PMID Text
11288140 Reports cloning of rat NID67 and discussion of mouse and human orthologs.

AA Sequence

MDAVSQVPMEVVLPKHILDIWVIVLIILATIVIMTSLLLCPATAVIIYRMRTHPILSGAV                1 - 60
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11288140 2001 NID67, a small putative membrane protein, is preferentially induced by NGF in PC12 pheochromocytoma cells.