Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.42
PubTator Score 232.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.46795984032742E-4
Multiple myeloma 1328 0.00362665692690639

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.220 0.004
psoriasis 1.600 0.000

Synonym

Accession Q9BZL1 Q2NL89
Symbols HUB1

Gene

PDB

4PYU   1P0R  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (8)

PMID Text
25862789 Findings establish UBL5 as a factor that promotes the functionality of the FA DNA repair pathway.
25092792 our results show that UBL5 plays an evolutionary conserved role in pre-mRNA splicing, the integrity of which is essential for the fidelity of chromosome segregation.
23726919 Results suggest that UBL5 could be targeted to Cajal bodies (CBs) via its interaction with coilin.
19189687 The UBL5 gene is unlikely to play a major role in the genetic susceptibility to early-onset obesity.
19189687 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
17036923 Observational study of gene-disease association. (HuGE Navigator)
15331561 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLEL      1 - 70
YYQ                                                                        71 - 73
//

Text Mined References (23)

PMID Year Title
25862789 2015 Ubiquitin-like protein UBL5 promotes the functional integrity of the Fanconi anemia pathway.
25092792 2014 UBL5 is essential for pre-mRNA splicing and sister chromatid cohesion in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23726919 2013 Human UBL5 protein interacts with coilin and meets the Cajal bodies.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21269460 2011 Initial characterization of the human central proteome.
19189687 2008 Identification of sequence variants in the UBL5 (ubiquitin-like 5 or BEACON) gene in obese children by PCR-SSCP: no evidence for association with obesity.
More...