Property Summary

NCBI Gene PubMed Count 46
PubMed Score 82.27
PubTator Score 594.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
malignant mesothelioma 3232
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Systemic lupus erythematosus 194 0.0 1.1
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0

Expression

  Differential Expression (22)

Disease log2 FC p
acute myeloid leukemia 1.300 3.9e-02
acute quadriplegic myopathy 1.196 5.2e-03
adult high grade glioma -1.400 6.5e-03
atypical teratoid / rhabdoid tumor -2.200 4.9e-07
ependymoma -1.100 1.7e-04
gastric carcinoma 1.200 1.1e-02
glioblastoma -1.500 6.1e-06
intraductal papillary-mucinous adenoma (... 1.400 2.4e-02
intraductal papillary-mucinous carcinoma... 1.500 3.0e-02
intraductal papillary-mucinous neoplasm ... 1.500 6.8e-03
juvenile dermatomyositis 1.342 3.8e-08
medulloblastoma, large-cell 1.100 9.4e-03
non-small cell lung cancer 1.263 3.6e-11
osteosarcoma 2.741 9.5e-08
ovarian cancer -1.400 2.1e-04
pancreatic cancer 1.600 6.3e-04
pancreatic ductal adenocarcinoma liver m... 1.500 4.8e-03
Pick disease 1.400 1.8e-04
pituitary cancer 1.100 6.2e-05
psoriasis -1.100 5.9e-08
sarcoidosis 1.200 4.9e-03
tuberculosis -1.200 4.3e-07

Protein-protein Interaction (5)

Gene RIF (30)

AA Sequence

MSISSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGALVPPAALISIIQKGLQYVEAEVSINEDG      1 - 70
TLFDGRPIESLSLIDAVMPDVVQTRQQAYRDKLAQQQAAAAAAAAAAASQQGSAKNGENTANGEENGAHT     71 - 140
IANNHTDMMEVDGDVEIPPNKAVVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGSTQLV    141 - 210
LRHCIREGGQDVPSNKDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWNKKGNF    211 - 280
ILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASCSTDMCIHVCKLGQDRPIKTFQGHTN    281 - 350
EVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASF    351 - 420
DSTVRLWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSYRGTGGIFEVC    421 - 490
WNAAGDKVGASASDGSVCVLDLRK                                                  491 - 514
//

Text Mined References (56)

PMID Year Title