Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.51
PubTator Score 8.39

Knowledge Summary

Patent (1,907)

Expression

Gene RIF (4)

PMID Text
19834535 Observational study of gene-disease association. (HuGE Navigator)
19025769 We conclude that the N-terminal domain of GPR61 is required for maintaining its constitutive activity and functions as a tethered intramolecular ligand.
15615699 Modeling rationalizes the effects of transmembrane proline mutants previously reported for another family of GPCR.
11690637 maps to chromosome 1, is widely expressed, with expression highest in the brain areas associated with cognition, learning, and memory.

AA Sequence

MESSPIPQSSGNSSTLGRVPQTPGPSTASGVPEVGLRDVASESVALFFMLLLDLTAVAGNAAVMAVIAKT      1 - 70
PALRKFVFVFHLCLVDLLAALTLMPLAMLSSSALFDHALFGEVACRLYLFLSVCFVSLAILSVSAINVER     71 - 140
YYYVVHPMRYEVRMTLGLVASVLVGVWVKALAMASVPVLGRVSWEEGAPSVPPGCSLQWSHSAYCQLFVV    141 - 210
VFAVLYFLLPLLLILVVYCSMFRVARVAAMQHGPLPTWMETPRQRSESLSSRSTMVTSSGAPQTTPHRTF    211 - 280
GGGKAAVVLLAVGGQFLLCWLPYFSFHLYVALSAQPISTGQVESVVTWIGYFCFTSNPFFYGCLNRQIRG    281 - 350
ELSKQFVCFFKPAPEEELRLPSREGSIEENFLQFLQGTGCPSESWVSRPLPSPKQEPPAVDFRIPGQIAE    351 - 420
ETSEFLEQQLTSDIIMSDSYLRPAASPRLES                                           421 - 451
//

Text Mined References (13)

PMID Year Title
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19025769 2009 The N-terminal domain of GPR61, an orphan G-protein-coupled receptor, is essential for its constitutive activity.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15615699 2005 A key role for transmembrane prolines in calcitonin receptor-like receptor agonist binding and signalling: implications for family B G-protein-coupled receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...