Property Summary

Ligand Count 2
NCBI Gene PubMed Count 11
PubMed Score 2.36
PubTator Score 3.43

Knowledge Summary

Patent (1,510)

TINX Plot

  Disease (3)

Disease Target Count P-value
medulloblastoma, large-cell 6241 1.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.100 1.7e-03

AA Sequence

MVFSAVLTAFHTGTSNTTFVVYENTYMNITLPPPFQHPDLSPLLRYSFETMAPTGLSSLTVNSTAVPTTP      1 - 70
AAFKSLNLPLQITLSAIMIFILFVSFLGNLVVCLMVYQKAAMRSAINILLASLAFADMLLAVLNMPFALV     71 - 140
TILTTRWIFGKFFCRVSAMFFWLFVIEGVAILLIISIDRFLIIVQRQDKLNPYRAKVLIAVSWATSFCVA    141 - 210
FPLAVGNPDLQIPSRAPQCVFGYTTNPGYQAYVILISLISFFIPFLVILYSFMGILNTLRHNALRIHSYP    211 - 280
EGICLSQASKLGLMSLQRPFQMSIDMGFKTRAFTTILILFAVFIVCWAPFTTYSLVATFSKHFYYQHNFF    281 - 350
EISTWLLWLCYLKSALNPLIYYWRIKKFHDACLDMMPKSFKFLPQLPGHTKRRIRPSAVYVCGEHRTVV     351 - 419
//

Text Mined References (11)

PMID Year Title