Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.17
PubTator Score 2.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 7.3e-07
lung adenocarcinoma 1.600 3.2e-15
medulloblastoma, large-cell 2.100 2.1e-05
non-small cell lung cancer 1.105 1.0e-20
tuberculosis 1.200 3.7e-06

Gene RIF (3)

AA Sequence

MADQDPAGISPLQQMVASGTGAVVTSLFMTPLDVVKVRLQSQRPSMASELMPSSRLWSLSYTKLPSSLQS      1 - 70
TGKCLLYCNGVLEPLYLCPNGARCATWFQDPTRFTGTMDAFVKIVRHEGTRTLWSGLPATLVMTVPATAI     71 - 140
YFTAYDQLKAFLCGRALTSDLYAPMVAGALARLGTVTVISPLELMRTKLQAQHVSYRELGACVRTAVAQG    141 - 210
GWRSLWLGWGPTALRDVPFSALYWFNYELVKSWLNGFRPKDQTSVGMSFVAGGISGTVAAVLTLPFDVVK    211 - 280
TQRQVALGAMEAVRVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEFGKSFFQR    281 - 350
LNQDRLLGG                                                                 351 - 359
//

Text Mined References (12)

PMID Year Title