Property Summary

NCBI Gene PubMed Count 12
Grant Count 1
R01 Count 1
Funding $37,446.4
PubMed Score 8.13
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 0.000

Gene RIF (1)

PMID Text
12391231 Delta tryptase transcripts have been detected in a wide variety of tissues including lung, heart, stomach, spleen, skin, and colon, and a recombinant form is proteolytically active.

AA Sequence

MLLLAPQMLSLLLLALPVLASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSL      1 - 70
IHPQWVLTAAHCVEPDIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNI     71 - 140
SSHIHTVTLPPASETFPPGMPCWVTGWGDVDNNVHLPPPYPLKEVEVPVVENHLCNAEYHTGLHTGHSFQ    141 - 210
IVRDDMLCAGSENHDSCQGDSGGPLVCKVNGT                                          211 - 242
//

Text Mined References (13)

PMID Year Title
19748655 2009 Human subjects are protected from mast cell tryptase deficiency despite frequent inheritance of loss-of-function mutations.
18854315 2008 Alternate mRNA splicing in multiple human tryptase genes is predicted to regulate tetramer formation.
18325577 2008 Chimerism, point mutation, and truncation dramatically transformed mast cell delta-tryptases during primate evolution.
17947681 2007 Mast cell alpha and beta tryptases changed rapidly during primate speciation and evolved from gamma-like transmembrane peptidases in ancestral vertebrates.
16751005 2006 Tryptase genetics and anaphylaxis.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391231 2002 Delta tryptase is expressed in multiple human tissues, and a recombinant form has proteolytic activity.
12217407 2002 New developments in the genetics and activation of mast cell proteases.
12100045 2002 Genetic deficiency of human mast cell alpha-tryptase.
More...