Property Summary

NCBI Gene PubMed Count 12
Grant Count 4
R01 Count 4
Funding $1,096,201
PubMed Score 8.62
PubTator Score 70.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
hepatocellular carcinoma 1.700 0.000
pancreatic cancer 1.600 0.003
acute quadriplegic myopathy 1.027 0.000
tuberculosis and treatment for 3 months -1.600 0.001
pancreatic carcinoma 1.600 0.003
invasive ductal carcinoma 1.300 0.011
ovarian cancer -1.500 0.005

Gene RIF (2)

PMID Text
17296875 Observational study of gene-disease association. (HuGE Navigator)
12084575 Data show that crooked neck activity appears essential as extracts depleted of hcrn fail to splice pre-mRNA. These and related data support the view that crooked neck is a phylogenetically conserved pre-mRNA splicing factor.

AA Sequence

MTATVENLTFQKDTLGNAVDKNTSRLELRSYSLAGRHGSTEPLVLAWSSQFRRLTWGCALDALHRSPCVA      1 - 70
ASQHGVTHLIRSSRTPHSTRCRKEDAQPGHHGNGAASVTAQARGQRSVLQVPLPVPRSCLFSESFVVSVS     71 - 140
SQSRFLASVPGTGVQRSTAADMAASTAAGKQRIPKVAKVKNKAPAEVQITAEQLLREAKERELELLPPPP    141 - 210
QQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWL    211 - 280
KYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYI    281 - 350
NFELRYKEVDRARTIYERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFA    351 - 420
KFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHN    421 - 490
YDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQA    491 - 560
SLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKNKLFKVYIELELQLREFDRCRKLYE    561 - 630
KFLEFGPENCTSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYR    631 - 700
RLLQRTQHVKVWISFAQFELSSGKEGSLTKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEEEFGTASD    701 - 770
KERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPEDAANQPNLKLLAMAKLWKKQQQEKEDAEHHPD    771 - 840
EDVDESES                                                                  841 - 848
//

Text Mined References (16)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21269460 2011 Initial characterization of the human central proteome.
17296875 2007 Corin I555(P568) allele is associated with enhanced cardiac hypertrophic response to increased systemic afterload.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15189447 2004 Interaction of U-box-type ubiquitin-protein ligases (E3s) with molecular chaperones.
14759258 2004 An unappreciated role for RNA surveillance.
More...