Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.12
PubTator Score 70.31

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.027 2.1e-04
hepatocellular carcinoma 1.700 3.2e-04
invasive ductal carcinoma 1.300 1.1e-02
ovarian cancer -1.500 5.1e-03
pancreatic cancer 1.600 3.2e-03
pancreatic carcinoma 1.600 3.2e-03
tuberculosis -1.500 2.3e-04

 GO Function (1)

Gene RIF (2)

AA Sequence

MTATVENLTFQKDTLGNAVDKNTSRLELRSYSLAGRHGSTEPLVLAWSSQFRRLTWGCALDALHRSPCVA      1 - 70
ASQHGVTHLIRSSRTPHSTRCRKEDAQPGHHGNGAASVTAQARGQRSVLQVPLPVPRSCLFSESFVVSVS     71 - 140
SQSRFLASVPGTGVQRSTAADMAASTAAGKQRIPKVAKVKNKAPAEVQITAEQLLREAKERELELLPPPP    141 - 210
QQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWL    211 - 280
KYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYI    281 - 350
NFELRYKEVDRARTIYERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFA    351 - 420
KFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHN    421 - 490
YDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQA    491 - 560
SLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKNKLFKVYIELELQLREFDRCRKLYE    561 - 630
KFLEFGPENCTSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYR    631 - 700
RLLQRTQHVKVWISFAQFELSSGKEGSLTKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEEEFGTASD    701 - 770
KERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPEDAANQPNLKLLAMAKLWKKQQQEKEDAEHHPD    771 - 840
EDVDESES                                                                  841 - 848
//

Text Mined References (16)

PMID Year Title