Property Summary

NCBI Gene PubMed Count 12
PubMed Score 29.21
PubTator Score 16.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active ulcerative colitis 1.013 1.9e-02
astrocytic glioma 1.800 6.8e-03
Astrocytoma, Pilocytic 2.300 3.4e-04
Breast cancer -1.900 7.1e-04
breast carcinoma -1.600 1.1e-16
cystic fibrosis 2.286 7.0e-06
ependymoma 1.600 1.1e-02
glioblastoma 2.600 1.6e-02
lung adenocarcinoma -1.500 3.2e-04
non-small cell lung cancer -1.734 2.4e-08
ovarian cancer -1.700 8.2e-06
pediatric high grade glioma 1.700 4.9e-02
pituitary cancer -1.400 1.6e-03
primitive neuroectodermal tumor 2.300 4.3e-02
subependymal giant cell astrocytoma -1.459 3.9e-02

Gene RIF (6)

AA Sequence

MSYPQGYLYQAPGSLALYSCPAYGASALAAPRSEELARSASGSAFSPYPGSAAFTAQAATGFGSPLQYSA      1 - 70
DAAAAAAGFPSYMGAPYDAHTTGMTGAISYHPYGSAAYPYQLNDPAYRKNATRDATATLKAWLNEHRKNP     71 - 140
YPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRNKSEDEDEDEGDATRSKDESPDKAQEG    141 - 210
TETSAEDEGISLHVDSLTDHSCSAESDGEKLPCRAGDPLCESGSECKDKYDDLEDDEDDDEEGERGLAPP    211 - 280
KPVTSSPLTGLEAPLLSPPPEAAPRGGRKTPQGSRTSPGAPPPASKPKLWSLAEIATSDLKQPSLGPGCG    281 - 350
PPGLPAAAAPASTGAPPGGSPYPASPLLGRPLYYTSPFYGNYTNYGNLNAALQGQGLLRYNSAAAAPGEA    351 - 420
LHTAPKAASDAGKAGAHPLESHYRSPGGGYEPKKDASEGCTVVGGGVQPYL                       421 - 471
//

Text Mined References (14)

PMID Year Title