Property Summary

NCBI Gene PubMed Count 11
PubMed Score 28.15
PubTator Score 16.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Lung diseases 48
Disease Target Count P-value
breast carcinoma 1614 1.06679824780065E-16
non-small cell lung cancer 2798 2.39584856770972E-8
posterior fossa group B ependymoma 1530 5.25661104004862E-6
cystic fibrosis 1670 7.03548051548672E-6
ovarian cancer 8492 8.15609537231182E-6
inflammatory breast cancer 404 5.65571541027376E-5
lung adenocarcinoma 2714 3.23438531448584E-4
pilocytic astrocytoma 3086 4.21649196710593E-4
pituitary cancer 1972 0.00155249973143354
astrocytic glioma 2241 0.00683432017074945
glioblastoma 5572 0.0161137035980893
active ulcerative colitis 477 0.0185272994232546
subependymal giant cell astrocytoma 2287 0.0385514795419844
primitive neuroectodermal tumor 3031 0.0429383283052097
pediatric high grade glioma 2712 0.0491838262780074

Expression

  Differential Expression (15)

Synonym

Accession Q9BZI1 Q68A19 Q7Z2I7
Symbols IRXA2

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
26560478 IRX2 transcription factor might represent a novel metastasis associated protein that acts as a negative regulator of cellular motility and as a repressor of chemokine expression and loss of IRX2 expression could therefore contribute to early hematogenous dissemination of breast cancer by sustaining chemokine secretion and enabling mobilization of tumor cells.
26062523 IRX2 modulates the expression levels of MMP2 and VEGF in an AKTdependent manner.
24806332 The mechanism by which IRX2 promoted cell proliferation and invasion by activating AKT and MMP9 was detected.
22210879 Results revealed 3 genes highly predictive of event-free survival (EFS), beyond age and MLL status: FLT3, IRX2, and TACC2.
18421076 Observational study of gene-disease association. (HuGE Navigator)
16752383 IRX2 represents a candidate target of 5p amplifications in soft tissue sarcomas and might play a crucial role during the progression of this disease.

AA Sequence

MSYPQGYLYQAPGSLALYSCPAYGASALAAPRSEELARSASGSAFSPYPGSAAFTAQAATGFGSPLQYSA      1 - 70
DAAAAAAGFPSYMGAPYDAHTTGMTGAISYHPYGSAAYPYQLNDPAYRKNATRDATATLKAWLNEHRKNP     71 - 140
YPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRNKSEDEDEDEGDATRSKDESPDKAQEG    141 - 210
TETSAEDEGISLHVDSLTDHSCSAESDGEKLPCRAGDPLCESGSECKDKYDDLEDDEDDDEEGERGLAPP    211 - 280
KPVTSSPLTGLEAPLLSPPPEAAPRGGRKTPQGSRTSPGAPPPASKPKLWSLAEIATSDLKQPSLGPGCG    281 - 350
PPGLPAAAAPASTGAPPGGSPYPASPLLGRPLYYTSPFYGNYTNYGNLNAALQGQGLLRYNSAAAAPGEA    351 - 420
LHTAPKAASDAGKAGAHPLESHYRSPGGGYEPKKDASEGCTVVGGGVQPYL                       421 - 471
//

Text Mined References (13)

PMID Year Title
26560478 2015 Iroquois homeobox 2 suppresses cellular motility and chemokine expression in breast cancer cells.
26062523 2015 IRX2-mediated upregulation of MMP-9 and VEGF in a PI3K/AKT-dependent manner.
25343990 2015 Genome-wide association study of selenium concentrations.
24806332 2014 Knockdown of IRX2 inhibits osteosarcoma cell proliferation and invasion by the AKT/MMP9 signaling pathway.
22210879 2012 Gene expression profiles predictive of outcome and age in infant acute lymphoblastic leukemia: a Children's Oncology Group study.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
18421076 2008 A genome-wide scan maps a novel high myopia locus to 5p15.
16752383 2006 Frequent amplifications and abundant expression of TRIO, NKD2, and IRX2 in soft tissue sarcomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...