Property Summary

NCBI Gene PubMed Count 18
PubMed Score 152.10
PubTator Score 86.72

Knowledge Summary


No data available


  Disease Sources (7)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.02773093322658E-7
osteosarcoma 7933 2.95693918376132E-5
ovarian cancer 8492 4.14244451429296E-5
Pick disease 1893 7.43010757358004E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00102751544303869
oligodendroglioma 2849 0.00243118560606268
ependymoma 2514 0.00267848888303063
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00423803623383318
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00758683433691659
astrocytic glioma 2241 0.00974717591475487
sarcoidosis 368 0.0118039379839624
Breast cancer 3099 0.0265848840380967
progressive supranuclear palsy 674 0.031280154511584
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Leukemia 88 0.0 1.0
Prostate cancer 172 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Klinefelter's syndrome 59 0.0 4.0


  Differential Expression (13)


Accession Q9BZH6 Q5VWA1 Q9P2J6
Symbols DR11


  Ortholog (13)

Pathway (1)

Gene RIF (6)

26178983 Cellular Protein WDR11 Interacts with Specific Herpes Simplex Virus Proteins at the trans-Golgi Network To Promote Virus Replication.
20887964 WDR11, a WD protein that interacts with transcription factor EMX1, is mutated in idiopathic hypogonadotropic hypogonadism and Kallmann syndrome, causing impaired pubertal development.
16385451 Observational study of gene-disease association. (HuGE Navigator)
12684693 Data show that the HTPAPL-WDR11-FGFR2 locus was more susceptible to recombination than to nucleotide substitution.
12684685 This gene is expressed on chromosome 10p26.
11536051 Represents a candidate gene for the frequently proposed tumor suppressor gene in 10q25-26, which is involved in tumorigenesis of glial and other tumors showing frequent alterations in the distal 10q region.

AA Sequence

GFKQGAVLFASKAGAAGKDLLNELESPKEEPIEE                                       1191 - 1224

Text Mined References (25)

PMID Year Title
26178983 2015 Cellular Protein WDR11 Interacts with Specific Herpes Simplex Virus Proteins at the trans-Golgi Network To Promote Virus Replication.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24105470 2014 A meta-analysis of genome-wide association studies for adiponectin levels in East Asians identifies a novel locus near WDR11-FGFR2.
23394947 2013 A systematic mammalian genetic interaction map reveals pathways underlying ricin susceptibility.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
21269460 2011 Initial characterization of the human central proteome.
20887964 2010 WDR11, a WD protein that interacts with transcription factor EMX1, is mutated in idiopathic hypogonadotropic hypogonadism and Kallmann syndrome.