Property Summary

NCBI Gene PubMed Count 21
PubMed Score 142.64
PubTator Score 86.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 2.500 9.7e-03
Breast cancer 2.600 2.7e-02
ependymoma 1.700 2.2e-02
intraductal papillary-mucinous adenoma (... 2.500 1.0e-03
intraductal papillary-mucinous carcinoma... 2.300 4.2e-03
juvenile dermatomyositis 1.124 1.0e-07
oligodendroglioma 2.600 2.4e-03
osteosarcoma 2.105 3.0e-05
ovarian cancer -1.400 2.0e-03
pancreatic ductal adenocarcinoma liver m... 1.736 7.6e-03
Pick disease -1.200 7.4e-04
progressive supranuclear palsy -1.200 3.1e-02
sarcoidosis 1.100 1.2e-02

Gene RIF (7)

AA Sequence

MLPYTVNFKVSARTLTGALNAHNKAAVDWGWQGLIAYGCHSLVVVIDSITAQTLQVLEKHKADVVKVKWA      1 - 70
RENYHHNIGSPYCLRLASADVNGKIIVWDVAAGVAQCEIQEHAKPIQDVQWLWNQDASRDLLLAIHPPNY     71 - 140
IVLWNADTGTKLWKKSYADNILSFSFDPFDPSHLTLLTSEGIVFISDFSPSKPPSGPGKKVYISSPHSSP    141 - 210
AHNKLATATGAKKALNKVKILITQEKPSAEFITLNDCLQLAYLPSKRNHMLLLYPREILILDLEVNQTVG    211 - 280
VIAIERTGVPFLQVIPCFQRDGLFCLHENGCITLRVRRSYNNIFTTSNEEPDPDPVQELTYDLRSQCDAI    281 - 350
RVTKTVRPFSMVCCPVNENAAALVVSDGRVMIWELKSAVCNRNSRNSSSGVSPLYSPVSFCGIPVGVLQN    351 - 420
KLPDLSLDNMIGQSAIAGEEHPRGSILREVHLKFLLTGLLSGLPAPQFAIRMCPPLTTKNIKMYQPLLAV    421 - 490
GTSNGSVLVYHLTSGLLHKELSIHSCEVKGIEWTSLTSFLSFATSTPNNMGLVRNELQLVDLPTGRSIAF    491 - 560
RGERGNDESAIEMIKVSHLKQYLAVVFRDKPLELWDVRTCTLLREMSKNFPTITALEWSPSHNLKSLRKK    561 - 630
QLATREAMARQTVVSDTELSIVESSVISLLQEAESKSELSQNISAREHFVFTDIDGQVYHLTVEGNSVKD    631 - 700
SARIPPDGSMGSITCIAWKGDTLVLGDMDGNLNFWDLKGRVSRGIPTHRSWVRKIRFAPGKGNQKLIAMY    701 - 770
NDGAEVWDTKEVQMVSSLRSGRNVTFRILDVDWCTSDKVILASDDGCIRVLEMSMKSACFRMDEQELTEP    771 - 840
VWCPYLLVPRASLALKAFLLHQPWNGQYSLDISHVDYPENEEIKNLLQEQLNSLSNDIKKLLLDPEFTLL    841 - 910
QRCLLVSRLYGDESELHFWTVAAHYLHSLSQEKSASTTAPKEAAPRDKLSNPLDICYDVLCENAYFQKFQ    911 - 980
LERVNLQEVKRSTYDHTRKCTDQLLLLGQTDRAVQLLLETSADNQHYYCDSLKACLVTTVTSSGPSQSTI    981 - 1050
KLVATNMIANGKLAEGVQLLCLIDKAADACRYLQTYGEWNRAAWLAKVRLNPEECADVLRRWVDHLCSPQ   1051 - 1120
VNQKSKALLVLLSLGCFFSVAETLHSMRYFDRAALFVEACLKYGAFEVTEDTEKLITAIYADYARSLKNL   1121 - 1190
GFKQGAVLFASKAGAAGKDLLNELESPKEEPIEE                                       1191 - 1224
//

Text Mined References (27)

PMID Year Title