Property Summary

NCBI Gene PubMed Count 19
Grant Count 26
R01 Count 15
Funding $3,459,937.74
PubMed Score 21.38
PubTator Score 19.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (13)

PMID Text
26033490 These findings provide new insights into the acetylcholine receptor-mediated regulatory mechanism of SLURP-2 expression in keratinocytes.
26025503 These studies suggest that lynx1 is a potential target both for development of drugs that may limit lung cancer growth as well as for drugs that may be effective for asthma or COPD treatment.
25571874 This epigenome-wide DNA methylation analysis in postmortem hippocampus and prefrontal cortex specimens confirmed LYNX1 DNA methylation profiles in major depression.
24877120 SLURP-2 downregulated TNFalpha and IFNgamma R in T-cells and reduced IL-6 production by macrophage
23585571 Micromolar affinities and fast washout rates measured for ws-LYNX1 and its mutants are in contrast to nanomolar affinities and irreversibility of binding for alpha-bungarotoxin and similar snake alpha-neurotoxins also targeting alpha7 nAChR.
21252236 Computer modeling, based on ws-LYNX1 NMR structure and AChBP x-ray structure, revealed a possible mode of ws-LYNX1 binding.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19639180 LY-6K meaningfully participates in breast cancer cell metastasis
18559515 decreased Lynx1 is associated with squamous cell lung carcinoma
17643396 anti-tumorigenic activities of SLURP-1 and -2 were demonstrated both in vitro and in vivo.
More...

AA Sequence

MTPLLTLILVVLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTSAAEAIWCHQCTGFGGCSH      1 - 70
GSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD              71 - 131
//

Text Mined References (20)

PMID Year Title
27098205 2016 Organization, evolution and functions of the human and mouse Ly6/uPAR family genes.
26033490 2015 Transcriptional regulation of SLURP2, a psoriasis-associated gene, is under control of IL-22 in the skin: A special reference to the nested gene LYNX1.
26025503 2015 Role of Lynx1 and related Ly6 proteins as modulators of cholinergic signaling in normal and neoplastic bronchial epithelium.
25571874 2015 Aberrant NMDA receptor DNA methylation detected by epigenome-wide analysis of hippocampus and prefrontal cortex in major depression.
24877120 2014 Anti-inflammatory effects of the nicotinergic peptides SLURP-1 and SLURP-2 on human intestinal epithelial cells and immunocytes.
23585571 2013 Water-soluble LYNX1 residues important for interaction with muscle-type and/or neuronal nicotinic receptors.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21252236 2011 NMR structure and action on nicotinic acetylcholine receptors of water-soluble domain of human LYNX1.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19639180 2009 Metastatic effect of LY-6K gene in breast cancer cells.
More...