Property Summary

NCBI Gene PubMed Count 34
PubMed Score 102.90
PubTator Score 31.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Low compliance bladder 11 4.025 2.0
Cervical cancer 24 3.121 1.6

Gene RIF (10)

AA Sequence

MNILAPVRRDRVLAELPQCLRKEAALHGHKDFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLIN      1 - 70
RFCKDTFDKNYKATIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASL     71 - 140
EHTKQWLADALKENDPSSVLLFLVGSKKDLSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFF    141 - 210
RVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP                         211 - 259
//

Text Mined References (40)

PMID Year Title