Property Summary

NCBI Gene PubMed Count 31
PubMed Score 96.09
PubTator Score 31.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (8)

PMID Text
25501506 MMP19 were positively correlated with RAB34.
23871933 Although Rab34 regulates both lysosomal positioning and lysosome to phagosome fusion, the latter effect is not due to the regulation of the cytoplasmic accessibility of lysosomes to phagosomes by Rab34.
19961360 Rab36 may regulate the spatial distribution of late endosomes and lysosomes through a similar mechanism to Rab34.
19641095 mechanistic basis for high glucose-induced protein secretion is through interaction of munc13 and rab34, indicating a potentially critical role for this newly described pathway in the pathogenesis of DN.
18005733 B coxsackievirus entry depends on occludin and require the activity of Rab34, Ras, and Rab5, GTPases known to regulate macropinocytosis.
17881736 define Rab34 as a novel member of the secretory pathway acting at the Golgi
16138900 Data suggest that diacylglycerol-activated hmunc13 serves as an effector of Rab34, mediating lysosome-Golgi trafficking.
15996637 The data together indicate that RILP, as already demonstrated for several other Rab effector proteins, is capable of self-association, thus probably forming a homo-dimer.

AA Sequence

MNILAPVRRDRVLAELPQCLRKEAALHGHKDFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLIN      1 - 70
RFCKDTFDKNYKATIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASL     71 - 140
EHTKQWLADALKENDPSSVLLFLVGSKKDLSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFF    141 - 210
RVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP                         211 - 259
//

Text Mined References (38)

PMID Year Title
25501506 2015 RAB34 was a progression- and prognosis-associated biomarker in gliomas.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
23871933 2013 Spatial distribution of phagolysosomes is independent of the regulation of lysosome position by Rab34.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21783985 2009 Ethanolic Hwaeumjeon induces mitochondrial dependent apoptosis partly via PI3K/AKT/HSP27/ERK pathways and inhibits PSA and AR in LNCaP cells.
21586586 2011 Identification and characterization of a novel ubiquitous nucleolar protein 'NARR' encoded by a gene overlapping the rab34 oncogene.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21255211 2011 Rab GTPases regulating phagosome maturation are differentially recruited to mycobacterial phagosomes.
19961360 2010 Rab36 regulates the spatial distribution of late endosomes and lysosomes through a similar mechanism to Rab34.
19717423 2009 The GTPase Rab3b/3c-positive recycling vesicles are involved in cross-presentation in dendritic cells.
19641095 2009 Rab34 and its effector munc13-2 constitute a new pathway modulating protein secretion in the cellular response to hyperglycemia.
19531230 2009 Down-regulated miR-9 and miR-433 in human gastric carcinoma.
19279100 2009 Kaposi's sarcoma-associated herpesvirus utilizes an actin polymerization-dependent macropinocytic pathway to enter human dermal microvascular endothelial and human umbilical vein endothelial cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18005733 2007 Coxsackievirus entry across epithelial tight junctions requires occludin and the small GTPases Rab34 and Rab5.
17881736 2007 Golgi-bound Rab34 is a novel member of the secretory pathway.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16473629 2005 Assay and functional properties of Rab34 interaction with RILP in lysosome morphogenesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16138900 2005 Diacylglycerol-activated Hmunc13 serves as an effector of the GTPase Rab34.
15996637 2005 The Rab-interacting lysosomal protein, a Rab7 and Rab34 effector, is capable of self-interaction.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14668488 2004 A unique region of RILP distinguishes it from its related proteins in its regulation of lysosomal morphology and interaction with Rab7 and Rab34.
12684051 2003 Rab39, a novel Golgi-associated Rab GTPase from human dendritic cells involved in cellular endocytosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475955 2002 Interorganellar regulation of lysosome positioning by the Golgi apparatus through Rab34 interaction with Rab-interacting lysosomal protein.
12446704 2003 Small GTPase Rah/Rab34 is associated with membrane ruffles and macropinosomes and promotes macropinosome formation.
1752434 1991 Molecular cloning of a member of a new class of low-molecular-weight GTP-binding proteins.