Property Summary

NCBI Gene PubMed Count 31
PubMed Score 96.09
PubTator Score 31.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q9BZG1 B4E3A0 E9PEJ9 Q5BJE6 Q8NCJ8 Q96AR4
Symbols RAH
RAB39

Gene

Gene RIF (8)

PMID Text
25501506 MMP19 were positively correlated with RAB34.
23871933 Although Rab34 regulates both lysosomal positioning and lysosome to phagosome fusion, the latter effect is not due to the regulation of the cytoplasmic accessibility of lysosomes to phagosomes by Rab34.
19961360 Rab36 may regulate the spatial distribution of late endosomes and lysosomes through a similar mechanism to Rab34.
19641095 mechanistic basis for high glucose-induced protein secretion is through interaction of munc13 and rab34, indicating a potentially critical role for this newly described pathway in the pathogenesis of DN.
18005733 B coxsackievirus entry depends on occludin and require the activity of Rab34, Ras, and Rab5, GTPases known to regulate macropinocytosis.
17881736 define Rab34 as a novel member of the secretory pathway acting at the Golgi
16138900 Data suggest that diacylglycerol-activated hmunc13 serves as an effector of Rab34, mediating lysosome-Golgi trafficking.
15996637 The data together indicate that RILP, as already demonstrated for several other Rab effector proteins, is capable of self-association, thus probably forming a homo-dimer.

AA Sequence

MNILAPVRRDRVLAELPQCLRKEAALHGHKDFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLIN      1 - 70
RFCKDTFDKNYKATIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASL     71 - 140
EHTKQWLADALKENDPSSVLLFLVGSKKDLSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFF    141 - 210
RVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP                         211 - 259
//

Text Mined References (38)

PMID Year Title
25501506 2015 RAB34 was a progression- and prognosis-associated biomarker in gliomas.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
23871933 2013 Spatial distribution of phagolysosomes is independent of the regulation of lysosome position by Rab34.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21783985 2009 Ethanolic Hwaeumjeon induces mitochondrial dependent apoptosis partly via PI3K/AKT/HSP27/ERK pathways and inhibits PSA and AR in LNCaP cells.
21586586 2011 Identification and characterization of a novel ubiquitous nucleolar protein 'NARR' encoded by a gene overlapping the rab34 oncogene.
More...