Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.36
PubTator Score 3.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.335 2.3e-04
adrenocortical carcinoma 2.428 1.4e-04
Amyotrophic lateral sclerosis 1.336 4.2e-07
atypical teratoid / rhabdoid tumor -2.300 2.7e-03
chronic rhinosinusitis -1.848 9.4e-03
cystic fibrosis 2.303 3.8e-07
glioblastoma -1.200 7.6e-03
group 4 medulloblastoma -2.900 1.3e-06
lung adenocarcinoma -1.200 1.2e-12
lung carcinoma -1.600 1.7e-10
medulloblastoma, large-cell -2.300 1.3e-05
nasopharyngeal carcinoma -1.300 3.7e-05
ovarian cancer -1.900 6.9e-06
pituitary cancer 1.500 2.9e-04
subependymal giant cell astrocytoma 1.594 1.6e-02

Gene RIF (5)

AA Sequence

MSSDEKGISPAHKTSTPTHRSASSSTSSQRDSRQSIHILERTASSSTEPSVSRQLLEPEPVPLSKEADSW      1 - 70
EIIEGLKIGQTNVQKPDKHEGFMLKKRKWPLKGWHKRFFVLDNGMLKYSKAPLDIQKGKVHGSIDVGLSV     71 - 140
MSIKKKARRIDLDTEEHIYHLKVKSQDWFDAWVSKLRHHRLYRQNEIVRSPRDASFHIFPSTSTAESSPA    141 - 210
ANVSVMDGKMQPNSFPWQSPLPCSNSLPATCTTGQSKVAAWLQDSEEMDRCAEDLAHCQSNLVELSKLLQ    211 - 280
NLEILQRTQSAPNFTDMQANCVDISKKDKRVTRRWRTKSVSKDTKIQLQVPFSATMSPVRLHSSNPNLCA    281 - 350
DIEFQTPPSHLTDPLESSTDYTKLQEEFCLIAQKVHSLLKSAFNSIAIEKEKLKQMVSEQDHSKGHSTQM    351 - 420
ARLRQSLSQALNQNAELRSRLNRIHSESIICDQVVSVNIIPSPDEAGEQIHVSLPLSQQVANESRLSMSE    421 - 490
SVSEFFDAQEVLLSASSSENEASDDESYISDVSDNISEDNTSVADNISRQILNGELTGGAFRNGRRACLP    491 - 560
APCPDTSNINLWNILRNNIGKDLSKVSMPVELNEPLNTLQHLCEEMEYSELLDKASETDDPYERMVLVAA    561 - 630
FAVSGYCSTYFRAGSKPFNPVLGETYECIREDKGFRFFSEQVSHHPPISACHCESKNFVFWQDIRWKNKF    631 - 700
WGKSMEILPVGTLNVMLPKYGDYYVWNKVTTCIHNILSGRRWIEHYGEVTIRNTKSSVCICKLTFVKVNY    701 - 770
WNSNMNEVQGVVIDQEGKAVYRLFGKWHEGLYCGVAPSAKCIWRPGSMPTNYELYYGFTRFAIELNELDP    771 - 840
VLKDLLPPTDARFRPDQRFLEEGNLEAAASEKQRVEELQRSRRRYMEENNLEHIPKFFKKVIDANQREAW    841 - 910
VSNDTYWELRKDPGFSKVDSPVLW                                                  911 - 934
//

Text Mined References (21)

PMID Year Title