Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.31
PubTator Score 3.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
medulloblastoma -3.000 0.000
cystic fibrosis 2.303 0.000
atypical teratoid / rhabdoid tumor -2.400 0.001
glioblastoma -1.200 0.008
medulloblastoma, large-cell -2.300 0.000
Amyotrophic Lateral Sclerosis 1.336 0.000
acute quadriplegic myopathy 1.972 0.000
adrenocortical carcinoma 2.428 0.000
lung adenocarcinoma -1.200 0.000
subependymal giant cell astrocytoma 1.773 0.012
nasopharyngeal carcinoma -1.300 0.000
lung carcinoma -1.600 0.000
ovarian cancer -1.900 0.000
pituitary cancer 1.900 0.000
chronic rhinosinusitis -1.848 0.009

 GO Function (1)

 GO Process (1)

Gene RIF (3)

PMID Text
22190034 HIV-1 PR is identified to have a physical interaction with oxysterol binding protein-like 6 (OSBPL6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19401682 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of oxysterol binding protein-like 6 (OSBPL6) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MSSDEKGISPAHKTSTPTHRSASSSTSSQRDSRQSIHILERTASSSTEPSVSRQLLEPEPVPLSKEADSW      1 - 70
EIIEGLKIGQTNVQKPDKHEGFMLKKRKWPLKGWHKRFFVLDNGMLKYSKAPLDIQKGKVHGSIDVGLSV     71 - 140
MSIKKKARRIDLDTEEHIYHLKVKSQDWFDAWVSKLRHHRLYRQNEIVRSPRDASFHIFPSTSTAESSPA    141 - 210
ANVSVMDGKMQPNSFPWQSPLPCSNSLPATCTTGQSKVAAWLQDSEEMDRCAEDLAHCQSNLVELSKLLQ    211 - 280
NLEILQRTQSAPNFTDMQANCVDISKKDKRVTRRWRTKSVSKDTKIQLQVPFSATMSPVRLHSSNPNLCA    281 - 350
DIEFQTPPSHLTDPLESSTDYTKLQEEFCLIAQKVHSLLKSAFNSIAIEKEKLKQMVSEQDHSKGHSTQM    351 - 420
ARLRQSLSQALNQNAELRSRLNRIHSESIICDQVVSVNIIPSPDEAGEQIHVSLPLSQQVANESRLSMSE    421 - 490
SVSEFFDAQEVLLSASSSENEASDDESYISDVSDNISEDNTSVADNISRQILNGELTGGAFRNGRRACLP    491 - 560
APCPDTSNINLWNILRNNIGKDLSKVSMPVELNEPLNTLQHLCEEMEYSELLDKASETDDPYERMVLVAA    561 - 630
FAVSGYCSTYFRAGSKPFNPVLGETYECIREDKGFRFFSEQVSHHPPISACHCESKNFVFWQDIRWKNKF    631 - 700
WGKSMEILPVGTLNVMLPKYGDYYVWNKVTTCIHNILSGRRWIEHYGEVTIRNTKSSVCICKLTFVKVNY    701 - 770
WNSNMNEVQGVVIDQEGKAVYRLFGKWHEGLYCGVAPSAKCIWRPGSMPTNYELYYGFTRFAIELNELDP    771 - 840
VLKDLLPPTDARFRPDQRFLEEGNLEAAASEKQRVEELQRSRRRYMEENNLEHIPKFFKKVIDANQREAW    841 - 910
VSNDTYWELRKDPGFSKVDSPVLW                                                  911 - 934
//

Text Mined References (19)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23166209 2012 Impact of ancestry and common genetic variants on QT interval in African Americans.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22190034 2011 Global landscape of HIV-human protein complexes.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
More...