Property Summary

NCBI Gene PubMed Count 23
Grant Count 122
R01 Count 72
Funding $18,561,634.19
PubMed Score 1605.12
PubTator Score 201.83

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BZE9 A8K3K9 Q7Z6N7 Q8WV59 Q96LS5 Q96M40
Symbols TUG
ASPL
ASPS
RCC17
UBXD9
UBXN9
ASPCR1

Gene

Gene RIF (10)

PMID Text
26516944 Studies indicate that alveolar soft part sarcoma showed a specific chromosomal alteration, der(17)t(X:17)(p11:q25), resulting in the fusion of the TFE3 transcription factor gene (Xp11) with alveolar soft part sarcoma critical region 1 (ASPSCR1) at 17q25.
25453902 A conditional expression in mice of the fusion gene ASPSCR1-TFE3 from human alveolar soft part sarcoma (ASPS) generated a model that recapitulates the human tumor histologically and by expression profile.
25078495 ASPL is a cofactor of the hexameric ATPase complex, known as p97. The central area in ASPL, containing both a SHP box and a UBX domain, is required for binding to the p97 N-domain.
23349634 Promotes methylation of VCP by METTL21D
23288701 Results support a gain-of-function role for ASPSCR1-TFE3 contributing to proliferation and survival of cancer cells.
22207755 Data support a model in which TUG controls p97 oligomeric status at a particular location in the early secretory pathway and in which this process regulates membrane trafficking in various cell types.
21835426 In alveolar soft part sarcomas with unusual locations or histology, we consider that the detection of the ASPSCR1-TFE3 fusion transcript would be the highly effective diagnostic technique.
21279521 Immuno-detection of TFE3 and RT-PCR-based identification of ASPL/TFE3 fusion transcripts are powerful tools in the diagnosis of alveolar soft part sarcoma.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18176180 Immunohistochemical discrimination between the ASPL-TFE3 fusion proteins of alveolar soft part sarcoma

AA Sequence

MAAPAGGGGSAVSVLAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFNPCEYDLKFQRSVLDLSLQWRFANL      1 - 70
PNNAKLEMVPASRSREGPENMVRIALQLDDGSRLQDSFCSGQTLWELLSHFPQIRECLQHPGGATPVCVY     71 - 140
TRDEVTGEAALRGTTLQSLGLTGGSATIRFVMKCYDPVGKTPGSLGSSASAGQAAASAPLPLESGELSRG    141 - 210
DLSRPEDADTSGPCCEHTQEKQSTRAPAAAPFVPFSGGGQRLGGPPGPTRPLTSSSAKLPKSLSSPGGPS    211 - 280
KPKKSKSGQDPQQEQEQERERDPQQEQERERPVDREPVDREPVVCHPDLEERLQAWPAELPDEFFELTVD    281 - 350
DVRRRLAQLKSERKRLEEAPLVTKAFREAQIKEKLERYPKVALRVLFPDRYVLQGFFRPSETVGDLRDFV    351 - 420
RSHLGNPELSFYLFITPPKTVLDDHTQTLFQANLFPAALVHLGAEEPAGVYLEPGLLEHAISPSAADVLV    421 - 490
ARYMSRAAGSPSPLPAPDPAPKSEPAAEEGALVPPEPIPGTAQPVKRSLGKVPKWLKLPASKR           491 - 553
//

Text Mined References (30)

PMID Year Title
26516944 2015 Alveolar Soft Part Sarcoma.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25453902 2014 Modeling alveolar soft part sarcomagenesis in the mouse: a role for lactate in the tumor microenvironment.
25416956 2014 A proteome-scale map of the human interactome network.
25078495 2014 Human ASPL/TUG interacts with p97 and complements the proteasome mislocalization of a yeast ubx4 mutant, but not the ER-associated degradation defect.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23349634 2013 A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.
23288701 2013 Combining integrated genomics and functional genomics to dissect the biology of a cancer-associated, aberrant transcription factor, the ASPSCR1-TFE3 fusion oncoprotein.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...