Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
posterior fossa group B ependymoma 1,530

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 2.300 0.000

Synonym

Accession Q9BZE7 Q5JYU9 Q96M68
Symbols EVG1
dJ1039K5.6

Gene

 Compartment GO Term (1)

AA Sequence

MASQKQMEVVTKGTGFRRRPKTITYTPGTCELLRVMMKESKLTNIQQRHIMDIMKRGDALPLQCSPTSSQ      1 - 70
RVLPSKQIASPIYLPPILAARPHLRPANMCQANGAYSREQFKPQATRDLEKEKQRLQNIFATGKDMEERK     71 - 140
RKAPPARQKAPAPELDRFEELVKEIQERKEFLADMEALGQGKQYRGIILAEISQKLREMEDIDHRRSEEL    141 - 210
RKGLATT                                                                   211 - 217
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11237012 2001 Experimental annotation of the human genome using microarray technology.
10591208 1999 The DNA sequence of human chromosome 22.