Property Summary

NCBI Gene PubMed Count 6
Grant Count 5
R01 Count 5
Funding $348,646.33
PubMed Score 11.79
PubTator Score 5.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
group 4 medulloblastoma 4.900 0.000

Gene RIF (1)

PMID Text
21602885 expression of Barhl1 decelerates tumor growth both in human and in murine medulloblastomas.

AA Sequence

MEGSNGFGIDSILSHRAGSPALPKGDPLLGDCRSPLELSPRSESSSDCSSPASPGRDCLETGTPRPGGAS      1 - 70
GPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDK     71 - 140
LDKSGSNASSDSEYKVKEEGDREISSSRDSPPVRLKKPRKARTAFTDHQLAQLERSFERQKYLSVQDRME    141 - 210
LAASLNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEAGNYSALQRMFPSPYFYPQSLVSNLDPGAALYLY    211 - 280
RGPSAPPPALQRPLVPRILIHGLQGASEPPPPLPPLAGVLPRAAQPR                           281 - 327
//

Text Mined References (9)

PMID Year Title
21602885 2011 Expression of BARHL1 in medulloblastoma is associated with prolonged survival in mice and humans.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15487006 2004 Mutational analysis of BARHL1 and BARX1 in three new patients with Joubert syndrome.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10814725 2000 Barhl1, a gene belonging to a new subfamily of mammalian homeobox genes, is expressed in migrating neurons of the CNS.