Property Summary

NCBI Gene PubMed Count 6
PubMed Score 12.31
PubTator Score 5.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
group 3 medulloblastoma 4104 9.0e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 2.600 9.0e-05

Gene RIF (1)

AA Sequence

MEGSNGFGIDSILSHRAGSPALPKGDPLLGDCRSPLELSPRSESSSDCSSPASPGRDCLETGTPRPGGAS      1 - 70
GPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDK     71 - 140
LDKSGSNASSDSEYKVKEEGDREISSSRDSPPVRLKKPRKARTAFTDHQLAQLERSFERQKYLSVQDRME    141 - 210
LAASLNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEAGNYSALQRMFPSPYFYPQSLVSNLDPGAALYLY    211 - 280
RGPSAPPPALQRPLVPRILIHGLQGASEPPPPLPPLAGVLPRAAQPR                           281 - 327
//

Text Mined References (9)

PMID Year Title