Property Summary

NCBI Gene PubMed Count 6
PubMed Score 15.37
PubTator Score 9.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung cancer 4473 0.040219876303907
acute myeloid leukemia 785 0.0413381898304422
Disease Target Count Z-score Confidence
Intellectual disability 573 0.0 4.0

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.500 0.040
acute myeloid leukemia -1.300 0.041

Synonym

Accession Q9BZE2 B2RAM0 Q96D17 Q96J23 Q96NB4
Symbols MRT55
FKSG32
2610020J05Rik

Gene

PANTHER Protein Class (1)

  Ortholog (14)

AA Sequence

MAYNDTDRNQTEKLLKRVRELEQEVQRLKKEQAKNKEDSNIRENSAGAGKTKRAFDFSAHGRRHVALRIA      1 - 70
YMGWGYQGFASQENTNNTIEEKLFEALTKTRLVESRQTSNYHRCGRTDKGVSAFGQVISLDLRSQFPRGR     71 - 140
DSEDFNVKEEANAAAEEIRYTHILNRVLPPDIRILAWAPVEPSFSARFSCLERTYRYFFPRADLDIVTMD    141 - 210
YAAQKYVGTHDFRNLCKMDVANGVINFQRTILSAQVQLVGQSPGEGRWQEPFQLCQFEVTGQAFLYHQVR    211 - 280
CMMAILFLIGQGMEKPEIIDELLNIEKNPQKPQYSMAVEFPLVLYDCKFENVKWIYDQEAQEFNITHLQQ    281 - 350
LWANHAVKTHMLYSMLQGLDTVPVPCGIGPKMDGMTEWGNVKPSVIKQTSAFVEGVKMRTYKPLMDRPKC    351 - 420
QGLESRIQHFVRRGRIEHPHLFHEEETKAKRDCNDTLEEENTNLETPTKRVCVDTEIKSII             421 - 481
//

Text Mined References (9)

PMID Year Title
27055666 2016 A homozygous truncating mutation in PUS3 expands the role of tRNA modification in normal cognition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11027153 2000 Pseudouridine synthase 3 from mouse modifies the anticodon loop of tRNA.