Property Summary

NCBI Gene PubMed Count 6
PubMed Score 16.43
PubTator Score 9.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
MENTAL RETARDATION, AUTOSOMAL RECESSIVE 55 1 0.0 0.0
Disease Target Count P-value
lung cancer 4740 4.0e-02
acute myeloid leukemia 783 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia -1.300 4.1e-02
lung cancer 1.500 4.0e-02

Synonym

Accession Q9BZE2 B2RAM0 Q96D17 Q96J23 Q96NB4
Symbols MRT55
FKSG32
2610020J05Rik

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAYNDTDRNQTEKLLKRVRELEQEVQRLKKEQAKNKEDSNIRENSAGAGKTKRAFDFSAHGRRHVALRIA      1 - 70
YMGWGYQGFASQENTNNTIEEKLFEALTKTRLVESRQTSNYHRCGRTDKGVSAFGQVISLDLRSQFPRGR     71 - 140
DSEDFNVKEEANAAAEEIRYTHILNRVLPPDIRILAWAPVEPSFSARFSCLERTYRYFFPRADLDIVTMD    141 - 210
YAAQKYVGTHDFRNLCKMDVANGVINFQRTILSAQVQLVGQSPGEGRWQEPFQLCQFEVTGQAFLYHQVR    211 - 280
CMMAILFLIGQGMEKPEIIDELLNIEKNPQKPQYSMAVEFPLVLYDCKFENVKWIYDQEAQEFNITHLQQ    281 - 350
LWANHAVKTHMLYSMLQGLDTVPVPCGIGPKMDGMTEWGNVKPSVIKQTSAFVEGVKMRTYKPLMDRPKC    351 - 420
QGLESRIQHFVRRGRIEHPHLFHEEETKAKRDCNDTLEEENTNLETPTKRVCVDTEIKSII             421 - 481
//

Text Mined References (9)

PMID Year Title