Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.00
PubTator Score 3.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Migraine Disorders 26
Disease Target Count P-value
ovarian cancer 8492 1.34046593383631E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0178799539623728
Disease Target Count Z-score Confidence
Thrombophilia 37 3.033 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.701 0.018
ovarian cancer 1.400 0.000

Synonym

Accession Q9BZE1 Q96Q67 Q9BWR1 Q9P0P3 L37mt
Symbols L2mt
L37mt
MRPL2
RPML2
MRP-L2
MRP-L37

Gene

PDB

3J9M   3J7Y  

  Ortholog (11)

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
15562971 MRPL37 gene is widely represented in the lymphoma populations of Raji B cells and MT4 T cells, as well as in pancreas, liver, and lung embryonic fibroblasts, which may imply the MRPL37 involvement in the process of apoptosis.

AA Sequence

MALASGPARRALAGSGQLGLGGFGAPRRGAYEWGVRSTRKSEPPPLDRVYEIPGLEPITFAGKMHFVPWL      1 - 70
ARPIFPPWDRGYKDPRFYRSPPLHEHPLYKDQACYIFHHRCRLLEGVKQALWLTKTKLIEGLPEKVLSLV     71 - 140
DDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHPSLARRICVQNSTFS    141 - 210
ATWNRESLLLQVRGSGGARLSTKDPLPTIASREEIEATKNHVLETFYPISPIIDLHECNIYDVKNDTGFQ    211 - 280
EGYPYPYPHTLYLLDKANLRPHRLQPDQLRAKMILFAFGSALAQARLLYGNDAKVLEQPVVVQSVGTDGR    281 - 350
VFHFLVFQLNTTDLDCNEGVKNLAWVDSDQLLYQHFWCLPVIKKRVVVEPVGPVGFKPETFRKFLALYLH    351 - 420
GAA                                                                       421 - 423
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...