Property Summary

NCBI Gene PubMed Count 22
PubMed Score 80.44
PubTator Score 14.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (15)

AA Sequence

MHSLDEPLDLKLSITKLRAAREKRERTLGVVRPRALHRELGLVDDSPTPGSPGSPPSGFLLNSKFPEKVE      1 - 70
GRFSAAPLVDLSLSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQFFLPLGSGG     71 - 140
ALHLPASSFLTPPKDKCLSPDLPLPKQLVCRWAKCNQLFELLQDLVDHVNDYHVKPEKDAGYCCHWEGCA    141 - 210
RHGRGFNARYKMLIHIRTHTNEKPHRCPTCSKSFSRLENLKIHNRSHTGEKPYVCPYEGCNKRYSNSSDR    211 - 280
FKHTRTHYVDKPYYCKMPGCHKRYTDPSSLRKHIKAHGHFVSHEQQELLQLRPPPKPPLPAPDGGPYVSG    281 - 350
AQIIIPNPAALFGGPGLPGLPLPLAPGPLDLSALACGNGGGSGGGGGMGPGLPGPVLPLNLAKNPLLPSP    351 - 420
FGAGGLGLPVVSLLAGAAGGKAEGEKGRGSVPTRALGMEGHKTPLERTESSCSRPSPDGLPLLPGTVLDL    421 - 490
STGVNSAASSPEALAPGWVVIPPGSVLLKPAVVN                                        491 - 524
//

Text Mined References (21)

PMID Year Title