Property Summary

NCBI Gene PubMed Count 18
Grant Count 32
R01 Count 15
Funding $3,000,495.98
PubMed Score 74.72
PubTator Score 14.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
26083374 Glis2/NPHP7 is extensively modified by post-translational modifications
24500717 BBS11 promotes accumulation of NPHP7, changing the properties of NPHP7. TRIM32 Modulates the Transcriptional Activities of Glis2
24127550 Findings are unprecedented and indicate that the DHH-RHEBL1 fusion transcript is a novel recurrent feature in the changing landscape of CBFA2T3-GLIS2-positive childhood AML.
23559409 Recessive mutation in GLIS2 gene is associated with Caroli disease.
23153540 Identification of a cryptic chromosome 16 inversion (inv(16)(p13.3q24.3)) in 27% of pediatric acute megakaryoblastic leukemia cases, which encodes a CBFA2T3-GLIS2 fusion protein.
21127075 Glis2 can function as a transcriptional activator and that post-translational modification within its DNA-binding domain can regulate its transcriptional activity
21068128 Observational study of gene-disease association. (HuGE Navigator)
17618285 Study identified Glis2 as a transcription factor mutated in Nephronophthisis and demonstrate its essential role for the maintenance of renal tissue architecture through prevention of apoptosis and fibrosis.
17344476 identification of Gli-similar 2 (Glis2) as a novel binding protein for p120 catenin
17289029 Glis2 functions as a negative modulator of beta-catenin/TCF-mediated transcription.
More...

AA Sequence

MHSLDEPLDLKLSITKLRAAREKRERTLGVVRPRALHRELGLVDDSPTPGSPGSPPSGFLLNSKFPEKVE      1 - 70
GRFSAAPLVDLSLSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQFFLPLGSGG     71 - 140
ALHLPASSFLTPPKDKCLSPDLPLPKQLVCRWAKCNQLFELLQDLVDHVNDYHVKPEKDAGYCCHWEGCA    141 - 210
RHGRGFNARYKMLIHIRTHTNEKPHRCPTCSKSFSRLENLKIHNRSHTGEKPYVCPYEGCNKRYSNSSDR    211 - 280
FKHTRTHYVDKPYYCKMPGCHKRYTDPSSLRKHIKAHGHFVSHEQQELLQLRPPPKPPLPAPDGGPYVSG    281 - 350
AQIIIPNPAALFGGPGLPGLPLPLAPGPLDLSALACGNGGGSGGGGGMGPGLPGPVLPLNLAKNPLLPSP    351 - 420
FGAGGLGLPVVSLLAGAAGGKAEGEKGRGSVPTRALGMEGHKTPLERTESSCSRPSPDGLPLLPGTVLDL    421 - 490
STGVNSAASSPEALAPGWVVIPPGSVLLKPAVVN                                        491 - 524
//

Text Mined References (17)

PMID Year Title
26083374 2015 SUMOylation Blocks the Ubiquitin-Mediated Degradation of the Nephronophthisis Gene Product Glis2/NPHP7.
24500717 2014 Interaction with the Bardet-Biedl gene product TRIM32/BBS11 modifies the half-life and localization of Glis2/NPHP7.
24127550 2013 DHH-RHEBL1 fusion transcript: a novel recurrent feature in the new landscape of pediatric CBFA2T3-GLIS2-positive acute myeloid leukemia.
23559409 2013 Identification of 99 novel mutations in a worldwide cohort of 1,056 patients with a nephronophthisis-related ciliopathy.
23153540 2012 An Inv(16)(p13.3q24.3)-encoded CBFA2T3-GLIS2 fusion protein defines an aggressive subtype of pediatric acute megakaryoblastic leukemia.
21127075 2011 Identification of nuclear localization, DNA binding, and transactivating mechanisms of Kruppel-like zinc finger protein Gli-similar 2 (Glis2).
21068128 2011 Mutation analysis of 18 nephronophthisis associated ciliopathy disease genes using a DNA pooling and next generation sequencing strategy.
17618285 2007 Loss of GLIS2 causes nephronophthisis in humans and mice by increased apoptosis and fibrosis.
17344476 2007 The transcriptional repressor Glis2 is a novel binding partner for p120 catenin.
17289029 2007 The Krüppel-like zinc finger protein Glis2 functions as a negative modulator of the Wnt/beta-catenin signaling pathway.
More...