Property Summary

NCBI Gene PubMed Count 5
Grant Count 3
R01 Count 3
Funding $126,680.43
PubMed Score 1.71
PubTator Score 5.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -2.700 0.001
ependymoma -3.100 0.001
oligodendroglioma -2.600 0.009
cutaneous lupus erythematosus -1.100 0.002
glioblastoma multiforme -2.000 0.000
atypical teratoid / rhabdoid tumor -1.400 0.012
medulloblastoma, large-cell -1.800 0.013
Atopic dermatitis -1.800 0.000
pediatric high grade glioma -1.600 0.001
group 3 medulloblastoma -1.600 0.034
pilocytic astrocytoma -2.200 0.000
psoriasis -1.200 0.000
invasive ductal carcinoma -2.300 0.001
Pick disease -1.700 0.001
Breast cancer -1.200 0.000
ductal carcinoma in situ -1.600 0.006

AA Sequence

MAVFLEAKDAHSVLKRFPRANEFLEELRQGTIERECMEEICSYEEVKEVFENKEKTMEFWKGYPNAVYSV      1 - 70
RDPSQSSDAMYVVVPLLGVALLIVIALFIIWRCQLQKATRHHPSYAQNRYLASRAGHTLPRVMVYRGTVH     71 - 140
SQGEPSGHREAANSPQVVLGPSRGGRTTVRLESTLYLPELSLSRLSSTTPPPSYEEVTAPQESSSEEASV    141 - 210
SYSDPPPKYEEIVAANPGADK                                                     211 - 231
//

Text Mined References (6)

PMID Year Title
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11171957 2001 Identification of two novel transmembrane gamma-carboxyglutamic acid proteins expressed broadly in fetal and adult tissues.