Property Summary

NCBI Gene PubMed Count 8
Grant Count 4
R01 Count 4
Funding $186,624.43
PubMed Score 2.24
PubTator Score 3.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
psoriasis 1.500 0.000
osteosarcoma -1.068 0.033
Atopic dermatitis 1.100 0.003
tuberculosis 2.900 0.000
non-small cell lung cancer 1.248 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.031
pancreatic cancer 1.100 0.000
interstitial cystitis -3.300 0.000
adult high grade glioma 1.400 0.004
pilocytic astrocytoma 1.900 0.000
lung carcinoma -1.600 0.000
spina bifida -2.181 0.038
ductal carcinoma in situ 1.400 0.004

Gene RIF (2)

PMID Text
24357251 the unique genotype identified in this study suggested that haploinsufficiencies of PAX6 or PRRG4 included in this region are candidate genes for severe developmental delay and autistic features characteristic of WAGR syndrome.
23873930 Cellular localization and characterization of cytosolic binding partners for Gla domain-containing proteins PRRG4 and PRRG2.

AA Sequence

MFTLLVLLSQLPTVTLGFPHCARGPKASKHAGEEVFTSKEEANFFIHRRLLYNRFDLELFTPGNLERECN      1 - 70
EELCNYEEAREIFVDEDKTIAFWQEYSAKGPTTKSDGNREKIDVMGLLTGLIAAGVFLVIFGLLGYYLCI     71 - 140
TKCNRLQHPCSSAVYERGRHTPSIIFRRPEEAALSPLPPSVEDAGLPSYEQAVALTRKHSVSPPPPYPGH    141 - 210
TKGFRVFKKSMSLPSH                                                          211 - 226
//

Text Mined References (9)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
24357251 2014 Narrowing of the responsible region for severe developmental delay and autistic behaviors in WAGR syndrome down to 1.6?Mb including PAX6, WT1, and PRRG4.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23873930 2013 Cellular localization and characterization of cytosolic binding partners for Gla domain-containing proteins PRRG4 and PRRG2.
19772629 2009 Genomewide association study for onset age in Parkinson disease.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11171957 2001 Identification of two novel transmembrane gamma-carboxyglutamic acid proteins expressed broadly in fetal and adult tissues.