Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.89
PubTator Score 3.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.400 3.6e-03
Astrocytoma, Pilocytic 1.900 7.9e-05
Atopic dermatitis 1.100 2.6e-03
ductal carcinoma in situ 1.200 5.2e-03
interstitial cystitis -1.700 2.5e-03
intraductal papillary-mucinous neoplasm ... 1.600 3.1e-02
lung carcinoma -1.600 3.8e-20
malignant mesothelioma 1.500 7.4e-07
non-small cell lung cancer 1.248 3.8e-08
osteosarcoma -1.059 1.1e-03
pancreatic cancer 1.100 3.0e-05
psoriasis 1.500 2.6e-07
spina bifida -2.181 3.8e-02
tuberculosis 1.400 1.6e-06

Gene RIF (3)

AA Sequence

MFTLLVLLSQLPTVTLGFPHCARGPKASKHAGEEVFTSKEEANFFIHRRLLYNRFDLELFTPGNLERECN      1 - 70
EELCNYEEAREIFVDEDKTIAFWQEYSAKGPTTKSDGNREKIDVMGLLTGLIAAGVFLVIFGLLGYYLCI     71 - 140
TKCNRLQHPCSSAVYERGRHTPSIIFRRPEEAALSPLPPSVEDAGLPSYEQAVALTRKHSVSPPPPYPGH    141 - 210
TKGFRVFKKSMSLPSH                                                          211 - 226
//

Text Mined References (10)

PMID Year Title