Property Summary

NCBI Gene PubMed Count 40
Grant Count 13
R01 Count 2
Funding $657,439.66
PubMed Score 48.76
PubTator Score 30.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

PMID Text
26045769 found LncRNA AF339813 was positively regulated by NUF2
25701787 hnRNP K binds to the promoter region of NUF2 and activates its transcription.
25481014 NUF2 was overexpressed in glioma tissues and differentially expressed in a series of glioma cell lines. Depletion of NUF2 by short-hairpin RNA inhibited cell growth in vitro and in vivo.
25374179 NUF2 plays a critical role in the regulation of HCC cell proliferation and apoptosis.
25370920 NUF2 silencing by RANi (RNA interference) reduced the proliferation and colony formation ability of pancreatic cancer cells in vitro.
24247253 These results suggest that CDCA1 could be a prognostic biomarker and a potential therapeutic target for colorectal cancers .
24129578 these findings demonstrated that three buried glutamic acid-lysine pairs, in concert with hydrophobic interactions of core residues, provide the major specificity and stability requirements for Hec1-Nuf2 dimerization
23056589 NDC80, NUF2 and PTN were significantly aberrantly overexpressed in serous adenocarcinomas.
21270439 These data suggest that the CH and tail domains of Hec1 generate essential contacts between kinetochores and microtubules in cells, whereas the Nuf2 CH domain does not.
20508983 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

METLSFPRYNVAEIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVN      1 - 70
SEVMYPHLMEGFLPFSNLVTHLDSFLPICRVNDFETADILCPKAKRTSRFLSGIINFIHFREACRETYME     71 - 140
FLWQYKSSADKMQQLNAAHQEALMKLERLDSVPVEEQEEFKQLSDGIQELQQSLNQDFHQKTIVLQEGNS    141 - 210
QKKSNISEKTKRLNELKLSVVSLKEIQESLKTKIVDSPEKLKNYKEKMKDTVQKLKNARQEVVEKYEIYG    211 - 280
DSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESELKKLKTEENSFKRLMIVKKE    281 - 350
KLATAQFKINKKHEDVKQYKRTVIEDCNKVQEKRGAVYERVTTINQEIQKIKLGIQQLKDAAEREKLKSQ    351 - 420
EIFLNLKTALEKYHDGIEKAAEDSYAKIDEKTAELKRKMFKMST                              421 - 464
//

Text Mined References (45)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26045769 2015 Downregulation of NUF2 inhibits tumor growth and induces apoptosis by regulating lncRNA AF339813.
25701787 2015 Heterogeneous nuclear ribonucleoprotein K upregulates the kinetochore complex component NUF2 and promotes the tumorigenicity of colon cancer cells.
25481014 2014 SiRNA-mediated knockdown against NUF2 suppresses tumor growth and induces cell apoptosis in human glioma cells.
25416956 2014 A proteome-scale map of the human interactome network.
25374179 2014 Silencing of NUF2 inhibits tumor growth and induces apoptosis in human hepatocellular carcinomas.
25370920 2015 siRNA-mediated knockdown against NUF2 suppresses pancreatic cancer proliferation in vitro and in vivo.
24621683 2014 Risk loci for chronic obstructive pulmonary disease: a genome-wide association study and meta-analysis.
24247253 2014 Cell division cycle-associated protein 1 overexpression is essential for the malignant potential of colorectal cancers.
24129578 2013 Complementary interhelical interactions between three buried Glu-Lys pairs within three heptad repeats are essential for Hec1-Nuf2 heterodimerization and mitotic progression.
More...