Property Summary

NCBI Gene PubMed Count 40
PubMed Score 48.76
PubTator Score 30.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 2.05081697696129E-64
non-small cell lung cancer 2798 3.60285728131343E-28
Breast cancer 3099 7.24374229574594E-24
atypical teratoid/rhabdoid tumor 1095 9.40572759243855E-12
glioblastoma 5572 6.66069686080137E-11
group 3 medulloblastoma 2254 2.05090142513544E-10
medulloblastoma, large-cell 6234 9.87770622271094E-9
lung adenocarcinoma 2714 1.25463941711882E-8
pediatric high grade glioma 2712 1.02949912775705E-7
primitive neuroectodermal tumor 3031 3.01318521882772E-7
ovarian cancer 8492 1.58576455614836E-6
posterior fossa group A ependymoma 1511 8.53759415427766E-6
Atopic dermatitis 944 1.63110413034343E-5
astrocytoma 1493 1.71891450649269E-5
pancreatic cancer 2300 1.91854660144329E-5
breast carcinoma 1614 2.74239220454239E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.0001140152201E-5
oligodendroglioma 2849 5.13563804244543E-5
invasive ductal carcinoma 2950 5.15151815657225E-5
nasopharyngeal carcinoma 1056 1.02318231950303E-4
pilocytic astrocytoma 3086 1.25380024480359E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 1.37006811475032E-4
ulcerative colitis 2087 7.79121683396912E-4
adrenocortical carcinoma 1427 0.00102886881434759
ductal carcinoma in situ 1745 0.010550356679791
active Crohn's disease 918 0.0113136538209777
Endometriosis 535 0.0134001448074975
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0215309467620621

Expression

Synonym

Accession Q9BZD4 Q8WU69 Q96HJ4 Q96Q78 hNuf2
Symbols CDCA1
CT106
NUF2R

Gene

PANTHER Protein Class (1)

PDB

2VE7   3IZ0  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (19)

PMID Text
26045769 found LncRNA AF339813 was positively regulated by NUF2
25701787 hnRNP K binds to the promoter region of NUF2 and activates its transcription.
25481014 NUF2 was overexpressed in glioma tissues and differentially expressed in a series of glioma cell lines. Depletion of NUF2 by short-hairpin RNA inhibited cell growth in vitro and in vivo.
25374179 NUF2 plays a critical role in the regulation of HCC cell proliferation and apoptosis.
25370920 NUF2 silencing by RANi (RNA interference) reduced the proliferation and colony formation ability of pancreatic cancer cells in vitro.
24247253 These results suggest that CDCA1 could be a prognostic biomarker and a potential therapeutic target for colorectal cancers .
24129578 these findings demonstrated that three buried glutamic acid-lysine pairs, in concert with hydrophobic interactions of core residues, provide the major specificity and stability requirements for Hec1-Nuf2 dimerization
23056589 NDC80, NUF2 and PTN were significantly aberrantly overexpressed in serous adenocarcinomas.
21270439 These data suggest that the CH and tail domains of Hec1 generate essential contacts between kinetochores and microtubules in cells, whereas the Nuf2 CH domain does not.
20508983 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

METLSFPRYNVAEIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVN      1 - 70
SEVMYPHLMEGFLPFSNLVTHLDSFLPICRVNDFETADILCPKAKRTSRFLSGIINFIHFREACRETYME     71 - 140
FLWQYKSSADKMQQLNAAHQEALMKLERLDSVPVEEQEEFKQLSDGIQELQQSLNQDFHQKTIVLQEGNS    141 - 210
QKKSNISEKTKRLNELKLSVVSLKEIQESLKTKIVDSPEKLKNYKEKMKDTVQKLKNARQEVVEKYEIYG    211 - 280
DSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESELKKLKTEENSFKRLMIVKKE    281 - 350
KLATAQFKINKKHEDVKQYKRTVIEDCNKVQEKRGAVYERVTTINQEIQKIKLGIQQLKDAAEREKLKSQ    351 - 420
EIFLNLKTALEKYHDGIEKAAEDSYAKIDEKTAELKRKMFKMST                              421 - 464
//

Text Mined References (45)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26045769 2015 Downregulation of NUF2 inhibits tumor growth and induces apoptosis by regulating lncRNA AF339813.
25701787 2015 Heterogeneous nuclear ribonucleoprotein K upregulates the kinetochore complex component NUF2 and promotes the tumorigenicity of colon cancer cells.
25481014 2014 SiRNA-mediated knockdown against NUF2 suppresses tumor growth and induces cell apoptosis in human glioma cells.
25416956 2014 A proteome-scale map of the human interactome network.
25374179 2014 Silencing of NUF2 inhibits tumor growth and induces apoptosis in human hepatocellular carcinomas.
25370920 2015 siRNA-mediated knockdown against NUF2 suppresses pancreatic cancer proliferation in vitro and in vivo.
24621683 2014 Risk loci for chronic obstructive pulmonary disease: a genome-wide association study and meta-analysis.
24247253 2014 Cell division cycle-associated protein 1 overexpression is essential for the malignant potential of colorectal cancers.
24129578 2013 Complementary interhelical interactions between three buried Glu-Lys pairs within three heptad repeats are essential for Hec1-Nuf2 heterodimerization and mitotic progression.
More...