Property Summary

NCBI Gene PubMed Count 44
PubMed Score 49.74
PubTator Score 30.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
active Crohn's disease 1.095 1.1e-02
adrenocortical carcinoma 2.441 1.0e-03
adult high grade glioma 2.500 4.6e-05
astrocytoma 1.100 1.7e-05
Astrocytoma, Pilocytic 1.200 1.4e-04
Atopic dermatitis 2.000 1.6e-05
atypical teratoid / rhabdoid tumor 3.300 3.7e-08
Breast cancer 3.100 2.7e-02
breast carcinoma 1.700 2.7e-05
ductal carcinoma in situ 2.000 1.1e-02
Endometriosis 2.016 1.3e-02
ependymoma 2.000 4.9e-05
glioblastoma 3.800 6.7e-11
group 3 medulloblastoma 5.100 2.1e-10
intraductal papillary-mucinous adenoma (... 1.600 2.2e-02
intraductal papillary-mucinous carcinoma... 2.800 4.0e-05
intraductal papillary-mucinous neoplasm ... 3.300 1.4e-04
invasive ductal carcinoma 2.900 5.2e-05
lung adenocarcinoma 1.200 3.3e-07
medulloblastoma, large-cell 4.100 9.9e-09
nasopharyngeal carcinoma 2.000 1.0e-04
non-small cell lung cancer 2.824 3.6e-28
oligodendroglioma 1.300 5.1e-05
ovarian cancer 3.100 1.6e-06
pancreatic cancer 1.700 1.9e-05
primitive neuroectodermal tumor 4.400 3.0e-07
psoriasis 1.400 3.2e-09
ulcerative colitis 1.300 7.8e-04

Protein-protein Interaction (3)

Gene RIF (21)

AA Sequence

METLSFPRYNVAEIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVN      1 - 70
SEVMYPHLMEGFLPFSNLVTHLDSFLPICRVNDFETADILCPKAKRTSRFLSGIINFIHFREACRETYME     71 - 140
FLWQYKSSADKMQQLNAAHQEALMKLERLDSVPVEEQEEFKQLSDGIQELQQSLNQDFHQKTIVLQEGNS    141 - 210
QKKSNISEKTKRLNELKLSVVSLKEIQESLKTKIVDSPEKLKNYKEKMKDTVQKLKNARQEVVEKYEIYG    211 - 280
DSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESELKKLKTEENSFKRLMIVKKE    281 - 350
KLATAQFKINKKHEDVKQYKRTVIEDCNKVQEKRGAVYERVTTINQEIQKIKLGIQQLKDAAEREKLKSQ    351 - 420
EIFLNLKTALEKYHDGIEKAAEDSYAKIDEKTAELKRKMFKMST                              421 - 464
//

Text Mined References (49)

PMID Year Title