Property Summary

NCBI Gene PubMed Count 22
PubMed Score 38.21
PubTator Score 14.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.500 3.4e-04
astrocytic glioma -1.500 3.1e-03
Astrocytoma, Pilocytic -2.700 1.2e-07
atypical teratoid / rhabdoid tumor -2.900 4.3e-11
ependymoma -1.900 2.7e-03
glioblastoma -2.300 1.5e-10
group 3 medulloblastoma -1.400 2.8e-03
intraductal papillary-mucinous adenoma (... -1.400 1.8e-04
intraductal papillary-mucinous carcinoma... -1.200 5.7e-04
intraductal papillary-mucinous neoplasm ... -1.900 6.4e-04
lung carcinoma 1.100 3.8e-26
medulloblastoma, large-cell -1.900 3.0e-04
oligodendroglioma -1.200 2.0e-02
osteosarcoma 1.031 5.7e-04
Pick disease 1.400 3.6e-03
pituitary cancer -1.200 4.6e-05

Pathway (1)

Gene RIF (7)

AA Sequence

MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDHDAIKLFIGQIPRNLDEKDL      1 - 70
KPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKAQSALHEQKTLPGMNRPIQVKPADSESRGG     71 - 140
SSCLRQPPSQDRKLFVGMLNKQQSEDDVRRLFEAFGNIEECTILRGPDGNSKGCAFVKYSSHAEAQAAIN    141 - 210
ALHGSQTMPGASSSLVVKFADTDKERTMRRMQQMAGQMGMFNPMAIPFGAYGAYAQALMQQQAALMASVA    211 - 280
QGGYLNPMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPIGVNGFTGLPPQANG    281 - 350
QPAAEAVFANGIHPYPAQSPTAADPLQQAYAGVQQYAGPAAYPAAYGQISQAFPQPPPMIPQQQREGPEG    351 - 420
CNLFIYHLPQEFGDAELMQMFLPFGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPKDANRPY        421 - 486
//

Text Mined References (26)

PMID Year Title