Property Summary

NCBI Gene PubMed Count 21
PubMed Score 29.79
PubTator Score 14.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 3.80259934524339E-26
posterior fossa group A ependymoma 1511 7.12660019313341E-26
pilocytic astrocytoma 3086 5.45679751639226E-17
atypical teratoid / rhabdoid tumor 4369 1.00356755653531E-10
adult high grade glioma 2148 2.8369793182749E-10
sonic hedgehog group medulloblastoma 1482 1.24511711921091E-7
glioblastoma 5572 3.6328817389551E-7
pituitary cancer 1972 4.60221844775682E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.79605385632284E-4
medulloblastoma, large-cell 6234 2.84823774371304E-4
osteosarcoma 7933 5.6954884830945E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.69862289723002E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 6.36580775679658E-4
astrocytic glioma 2241 0.00180646625111122
Pick disease 1893 0.00356509414233167
oligodendroglioma 2849 0.00758526274239312

Expression

Synonym

Accession Q9BZC1 Q59EN7 Q86XB9 Q8N2M6 Q9BQ96 Q9NR84 Q9NR85 CELF-4
Symbols CELF-4
BRUNOL4

Gene

PDB

2DGP   2DNK  

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (6)

PMID Text
26811534 Authors report a modifying effect of a polymorphism of CELF4 on the dose-dependent association between anthracyclines and cardiomyopathy, which possibly occurs through a pathway that involves the expression of abnormally spliced TNNT2 variants.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19911421 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
17672918 validated occurrence of an unusual TG 3' splice site in intron 6
14973222 Determination of CELF4 protein domains required for RNA splicing.

AA Sequence

MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDHDAIKLFIGQIPRNLDEKDL      1 - 70
KPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKAQSALHEQKTLPGMNRPIQVKPADSESRGG     71 - 140
SSCLRQPPSQDRKLFVGMLNKQQSEDDVRRLFEAFGNIEECTILRGPDGNSKGCAFVKYSSHAEAQAAIN    141 - 210
ALHGSQTMPGASSSLVVKFADTDKERTMRRMQQMAGQMGMFNPMAIPFGAYGAYAQALMQQQAALMASVA    211 - 280
QGGYLNPMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPIGVNGFTGLPPQANG    281 - 350
QPAAEAVFANGIHPYPAQSPTAADPLQQAYAGVQQYAGPAAYPAAYGQISQAFPQPPPMIPQQQREGPEG    351 - 420
CNLFIYHLPQEFGDAELMQMFLPFGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPKDANRPY        421 - 486
//

Text Mined References (25)

PMID Year Title
26811534 2016 CELF4 Variant and Anthracycline-Related Cardiomyopathy: A Children's Oncology Group Genome-Wide Association Study.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19911421 2010 Prognostic relevance of DNA copy number changes in colorectal cancer.
19720736 2009 MBNL and CELF proteins regulate alternative splicing of the skeletal muscle chloride channel CLCN1.
19359265 2009 A genome-wide association study identifies a novel locus on chromosome 18q12.2 influencing white cell telomere length.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18521091 2009 Whole genome association study identifies polymorphisms associated with QT prolongation during iloperidone treatment of schizophrenia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...