Property Summary

NCBI Gene PubMed Count 30
Grant Count 16
R01 Count 16
Funding $1,570,480.91
PubMed Score 10.20
PubTator Score 23.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Prostatic Neoplasms 471

Expression

Gene RIF (10)

PMID Text
23600975 the PCDH11X/Y gene pair determines cerebral asymmetry by initiating the right shift in Homo sapiens
22744706 PCDH11Y expression was detected in the fetal neocortex, ganglionic eminences, cerebellum, and inferior olive. In the adult brain, the cerebral cortex, hippocampal formation, and cerebellum and brain stem were immunoreactive.
21276771 Our data...extended the lack of association of late-onset Alzheimer's disease to common PCDH11Y variants.
19859901 The present article investigated the patterns of alternative splicing and expression of the PCDH11X/Y genes.
19125366 We consider that a stronger case can be mounted for the Protocadherin11X/Y gene pair located in the hominid specific Xq21.3/Yp11.2 region of homology that was generated by a duplication from the X
18938061 This study provided the evidence for positive selection on Protocadherin Y gene in human lineage for schizophrenia.
16874762 a candidate for the evolution of hominid-specific characteristics including the sexual dimorphism of cerebral asymmetry, a putative correlate of language
16637074 Our findings suggest a novel mechanism for the progression of CaP involving expression of PCDH-PC. This novel protocadherin induces Wnt signaling, promotes malignant behavior and hormone-resistance of CaP cells.
16331680 Findings do not support the role of PCDH11Y, or more generally of a frequent specific Y chromosome, in the susceptibility to these neuropsychiatric disorders.
12420223 A 4.8 kb cDNA was cloned from TPA-resistance LNCaP prostate cancer cells. It is an unusual protocadherin family gene with 2 large overlapping ORFs encoding homologous polypeptides, one with and one without a signal sequence. [protocadherin-PC]

AA Sequence

MFRVGFLIISSSSSLSPLLLVSVVRVNTTNCHKCLLSGTYIFAVLLVCVVFHSGAQEKNYTIREEIPENV      1 - 70
LIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFY     71 - 140
EVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL    141 - 210
IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPV    211 - 280
FKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDRE    281 - 350
ETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDK    351 - 420
DADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKD    421 - 490
ENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKL    491 - 560
DREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPD    561 - 630
YGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVND    631 - 700
NKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEK    701 - 770
CDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTS    771 - 840
DYVKILVAAVAGTITVVVVIFITAVVRCRQAPHLKAAQKNMQNSEWATPNPENRQMIMMKKKKKKKKHSP    841 - 910
KNLLLNVVTIEETKADDVDSDGNRVTLDLPIDLEEQTMGKYNWVTTPTTFKPDSPDLARHYKSASPQPAF    911 - 980
QIQPETPLNLKHHIIQELPLDNTFVACDSISNCSSSSSDPYSVSDCGYPVTTFEVPVSVHTRPSQRRVTF    981 - 1050
HLPEGSQESSSDGGLGDHDAGSLTSTSHGLPLGYPQEEYFDRATPSNRTEGDGNSDPESTFIPGLKKEIT   1051 - 1120
VQPTVEEASDNCTQECLIYGHSDACWMPASLDHSSSSQAQASALCHSPPLSQASTQHHSPPVTQTIVLCH   1121 - 1190
SPPVTQTIALCHSPPPIQVSALHHSPPLVQGTALHHSPPSAQASALCYSPPLAQAAAISHSSSLPQVIAL   1191 - 1260
HRSQAQSSVSLQQGWVQGANGLCSVDQGVQGSATSQFYTMSERLHPSDDSIKVIPLTTFAPRQQARPSRG   1261 - 1330
DSPIMETHPL                                                               1331 - 1340
//

Text Mined References (30)

PMID Year Title
23600975 2013 The protocadherin 11X/Y (PCDH11X/Y) gene pair as determinant of cerebral asymmetry in modern Homo sapiens.
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
22744706 2013 Protocadherin 11X/Y a human-specific gene pair: an immunohistochemical survey of fetal and adult brains.
21480486 2011 Non-syndromic language delay in a child with disruption in the Protocadherin11X/Y gene pair.
21276771 2011 Lack of association between protocadherin 11-X/Y (PCDH11X and PCDH11Y) polymorphisms and late onset Alzheimer's disease.
20503398 2010 Relaxin drives Wnt signaling through upregulation of PCDHY in prostate cancer.
19859901 2010 Quantitative analysis of alternative transcripts of human PCDH11X/Y genes.
19812029 2010 Footprints of X-to-Y gene conversion in recent human evolution.
19125366 2009 Where and what is the right shift factor or cerebral dominance gene? A critique of Francks et al. (2007).
18938061 2009 Evidence for positive selection on Protocadherin Y gene in Homo sapiens: implications for schizophrenia.
More...